Details for Arabidopsis Locus AT3G08500

Position : Chr3 ( 5`- 2576794 .. 2578246 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G08500

Protein [Map View]
MMMRKPDITTIRDKGKPNHACGGNNNKPKLRKGLWSPDEDEKLIRYMLTNGQGCWSDIARNAGLLRCGKSCRLRWINYLR
PDLKRGSFSPQEEDLIFHLHSILGNRWSQIATRLPGRTDNEIKNFWNSTLKKRLKNNSNNNTSSGSSPNNSNSNSLDPRD
QHVDMGGNSTSLMDDYHHDENMMTVGNTMRMDSSSPFNVGPMVNSVGLNQLYDPLMISVPDNGYHQMGNTVNVFSVNGLG
DYGNTILDPISKRVSVEGDDWFIPPSENTNVIACSTSNNLNLQALDPCFNSKNLCHSESFKVGNVLGIENGSWEIENPKI
GDWDLDGLIDNNSSFPFLDFQVD*

DNA
ATGATGATGAGGAAACCGGACATTACTACGATCAGAGACAAAGGCAAGCCAAATCATGCATGTGGTGGTAATAACAACAA
ACCGAAGCTAAGAAAAGGACTTTGGTCGCCTGATGAAGATGAGAAGCTGATAAGATACATGTTGACTAATGGACAAGGAT
GTTGGAGTGACATCGCTAGAAATGCTGGTCTTTTACGTTGTGGTAAAAGTTGTCGCCTTCGCTGGATCAATTACTTGAGG
CCTGATCTTAAACGTGGATCCTTCTCTCCTCAGGAGGAGGATCTCATCTTCCATTTGCATTCCATTCTTGGTAACAGGTG
GTCTCAAATAGCTACTCGGCTTCCAGGTAGAACAGACAACGAGATCAAAAACTTTTGGAACTCGACATTGAAGAAGCGGC
TTAAGAACAACAGCAACAACAATACTTCATCAGGATCATCACCTAACAATAGTAATAGTAATTCCTTGGACCCAAGAGAT
CAACATGTGGATATGGGAGGCAACTCAACTTCATTGATGGATGACTATCATCATGATGAAAACATGATGACAGTGGGGAA
CACCATGCGCATGGACTCTTCCTCCCCATTCAATGTTGGACCAATGGTTAATAGTGTGGGCTTAAACCAACTTTATGATC
CCTTGATGATATCAGTGCCGGATAACGGATATCACCAAATGGGAAACACAGTGAATGTGTTCAGCGTTAATGGTTTAGGA
GATTATGGAAACACAATTCTTGATCCAATTAGCAAGAGAGTATCAGTAGAAGGTGATGATTGGTTCATTCCCCCCTCGGA
GAATACCAACGTCATTGCTTGTAGTACAAGCAACAACCTAAACTTACAGGCCCTTGATCCTTGCTTCAATAGCAAAAATC
TTTGTCATTCAGAAAGCTTCAAGGTAGGGAATGTGTTGGGGATAGAGAATGGTTCTTGGGAAATAGAAAACCCTAAAATC
GGAGATTGGGATTTGGATGGTCTCATCGATAACAACTCTTCTTTTCCCTTCCTTGATTTCCAAGTCGATTGA