Details for Arabidopsis Locus AT3G08020

Position : Chr3 ( 5`- 2557437 .. 2561802 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G08020

Protein [Map View]
MAFHVACPITCRRICHCSLGFSRDLRGANAKHKFLKEVIRVEEFLKDPAVSSNVFIGGTVQVRVPKVVPAPQTVSILGVG
DGAIGSGVDELAEEASAQKKRVALQRQAAVTVEAAEDYARRFESGVNDLTSNDHAGEELGHSGMNIMCRMCFLGEGEGSD
RARRMLSCKDCGKKYHKNCLKSWAQHRDLFHWSSWSCPSCRVCEVCRRTGDPNKFMFCKRCDAAYHCYCQHPPHKNVSSG
PYLCPKHTRCHSCDSTVPGNGLSVRWFLSYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDICQRWVHCHCDGISD
DKYMQFQVDGKLQYKCATCRGECYQVKDLQDAVQELWKKKDVVDKELIASLRAAAGLPTEEEIFSIFPFSDDEENGPVSG
RSLKFSIKGLVEKSPKKSKEYGKHSSSKKHASKKGSHTKLEPEVHQEIGSERRRLGGVRIDNVGFQINEQSDVNSSVAGI
CSTHEPKIVKHKRVDDVMVTDEEKPSRIVRIKCSKPHDSDSEDTLRNAGEEKSVKAKKLVINLGARKINVSGSSKSNVVS
HLSRDKDQSTLGGDKVDQTGEVRTLKISGRFGKTQSEGSKATFGSVTQFPAASTSEGNHVDDKTSISPALQKEARPLLKF
KLRKPNSGDQTSSVTTQSEDEKLSSAKGQRSKRKRPSSLVDMASLKEDGEATTHSHQDNSRNDEMMDANWILKKLGKDSI
GKRVEVHGSQNSWRKGTVTDVSGDTSTLSVSLDDGSIKTFELGKHSVRFIPQKQKRSRS*

DNA
ATGGCCTTTCACGTAGCTTGTCCAATTACATGTCGTCGGATTTGCCATTGCTCCTTAGGGTTTTCTCGGGATCTCCGTGG
AGCCAATGCGAAACATAAGTTTTTGAAAGAGGTTATTCGAGTGGAGGAGTTTCTCAAGGATCCTGCTGTTTCTTCTAATG
TTTTTATTGGAGGTACCGTTCAAGTTAGGGTTCCTAAGGTTGTTCCTGCTCCTCAGACGGTTTCGATTTTGGGGGTTGGA
GATGGTGCTATTGGTTCTGGTGTTGATGAATTGGCGGAGGAAGCTTCTGCTCAGAAGAAACGTGTTGCTCTTCAGAGACA
AGCTGCTGTTACTGTCGAAGCTGCTGAGGATTATGCTCGGAGGTTTGAATCTGGTGTCAATGACCTTACCTCAAACGATC
ATGCTGGTGAAGAATTAGGCCACTCCGGCATGAATATAATGTGCAGAATGTGCTTCCTAGGAGAAGGTGAAGGAAGTGAT
AGAGCAAGGAGGATGCTTTCTTGTAAAGACTGTGGAAAGAAGTACCACAAGAATTGTTTAAAGTCTTGGGCTCAACATAG
AGATTTATTTCATTGGAGTTCATGGAGTTGTCCCTCTTGCCGGGTTTGTGAGGTCTGCCGTAGAACAGGAGATCCTAACA
AGTTCATGTTCTGCAAAAGGTGTGATGCTGCTTACCATTGTTATTGCCAACATCCTCCACACAAGAATGTTAGTTCTGGG
CCATATCTCTGCCCAAAGCATACAAGATGCCACAGCTGTGATTCTACTGTCCCTGGAAATGGCCTGAGTGTCAGGTGGTT
TTTATCATATACTTGCTGTGATGCTTGTGGCAGATTGTTTGTTAAGGGAAATTATTGCCCTGTATGCTTGAAGGTGTATA
GGGATTCGGAATCAACCCCAATGGTATGCTGCGATATTTGTCAACGCTGGGTGCATTGCCATTGTGATGGAATAAGTGAT
GACAAATATATGCAGTTTCAAGTTGATGGAAAGCTACAATATAAATGTGCCACATGCCGTGGGGAGTGTTATCAGGTGAA
GGATCTTCAGGATGCAGTTCAAGAACTTTGGAAGAAAAAAGATGTGGTGGACAAAGAGTTGATTGCTAGTTTAAGGGCTG
CTGCTGGTTTGCCAACAGAGGAGGAAATATTTTCGATATTTCCATTTTCAGATGATGAAGAAAATGGACCCGTATCTGGG
CGCTCACTGAAGTTTTCGATTAAAGGTTTGGTGGAAAAATCCCCAAAGAAAAGCAAGGAGTATGGGAAACACTCTTCAAG
TAAAAAGCATGCTAGTAAAAAAGGTAGTCACACTAAGTTGGAGCCTGAAGTTCATCAGGAGATTGGATCTGAGAGACGCC
GACTAGGTGGTGTTAGAATTGATAATGTGGGTTTTCAGATAAACGAACAATCGGACGTTAATTCTTCTGTAGCTGGAATT
TGCTCAACACATGAACCTAAGATTGTAAAACACAAGAGGGTTGATGATGTTATGGTGACTGATGAAGAAAAGCCGTCAAG
GATAGTGAGAATAAAGTGTAGCAAGCCTCATGATTCTGATAGCGAGGATACCCTAAGGAATGCAGGGGAGGAAAAATCTG
TAAAGGCAAAGAAGTTGGTTATTAATCTGGGTGCTAGGAAAATAAATGTCAGTGGTTCTTCGAAGTCCAATGTTGTTTCT
CATTTATCGAGAGACAAAGATCAGTCCACTTTGGGTGGGGATAAAGTTGATCAGACTGGGGAAGTAAGAACCCTGAAGAT
CTCTGGAAGGTTTGGGAAAACTCAATCTGAAGGAAGTAAAGCTACATTTGGGTCAGTCACTCAGTTCCCTGCTGCATCAA
CAAGTGAAGGAAATCATGTGGATGACAAAACATCCATCTCACCAGCATTACAGAAAGAAGCAAGACCTCTGCTGAAATTT
AAACTCAGGAAACCTAATTCAGGAGATCAGACATCTTCGGTTACAACGCAGTCTGAAGATGAAAAATTGAGTTCTGCAAA
GGGCCAAAGATCAAAGAGAAAGAGACCTTCAAGCTTAGTGGACATGGCTTCATTGAAAGAAGACGGTGAAGCTACAACAC
ATTCTCATCAGGATAATTCAAGGAACGACGAGATGATGGATGCTAACTGGATTTTGAAAAAGTTGGGTAAAGATTCAATA
GGAAAGAGAGTCGAAGTCCATGGATCTCAAAACTCATGGCGTAAGGGAACAGTGACAGACGTTTCTGGAGACACATCCAC
ATTGTCGGTTTCTCTAGATGATGGAAGCATCAAGACATTTGAACTTGGGAAGCACAGTGTCCGCTTCATACCGCAAAAGC
AAAAGAGGTCAAGGAGCTGA