Details for Arabidopsis Locus AT3G08010

Position : Chr3 ( 5`- 2555971 .. 2557505 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G08010

Protein [Map View]
MATLGFNTRRIQTPSLPRIPKPSSFTKPIKTHHLFSSETLLKRCRFVSRSLPESSLSITKEQEVANEVEEDDPTSELSYL
DPESDADSIKEWELDFCSRPILDSRGKKIWELVVCDASLSLQVTKYFPNNVINSITLKDAIVTITQDLGVPLPEKIRFFR
SQMQTIITKACKELAIKAVPSKRCLSLFLWLQERYDTVYTRHPGFQKGSLPLLSLDNPFPMNLPENLFGEKWAFVQLPYS
AVREEISDFDEKFVFGASLDLDLLGIEVDENTLIPGLSVATSRAKPLAAWMNGLEVCSIEADSSKGCLILSVGIATRYVY
ATYKKTPVTTDEAEAWESAKKTSGGLHFLAIQDDLDSDDCVGFWLLIDLPPPPV*

DNA
ATGGCGACGTTAGGCTTTAACACAAGGCGAATCCAGACACCATCACTTCCGAGAATCCCTAAACCCTCTTCTTTTACTAA
ACCCATCAAAACCCATCATCTCTTCTCCTCCGAAACTCTGTTGAAACGCTGCCGTTTCGTCTCTAGATCGTTACCTGAGA
GCTCACTGTCGATTACAAAAGAACAAGAGGTAGCTAATGAAGTAGAAGAAGATGATCCAACTTCAGAGCTGAGCTATCTG
GATCCTGAATCCGATGCGGATAGCATCAAAGAGTGGGAATTGGATTTCTGCTCGAGGCCTATTCTTGATTCCAGAGGGAA
AAAGATTTGGGAGCTTGTGGTTTGTGATGCTTCACTCTCCCTTCAAGTCACTAAATACTTCCCCAATAACGTCATTAATA
GTATTACTCTCAAAGACGCCATTGTTACCATCACTCAAGACTTGGGTGTTCCTCTTCCTGAGAAGATTCGCTTCTTCAGG
TCACAGATGCAAACCATTATCACAAAAGCTTGCAAAGAGCTTGCCATAAAGGCAGTGCCTAGTAAACGGTGTCTGTCTCT
GTTTCTGTGGTTGCAAGAACGTTATGACACTGTGTACACGCGTCATCCCGGTTTCCAAAAGGGATCATTGCCTCTTCTGT
CTCTCGACAATCCCTTTCCAATGAATCTTCCGGAGAACTTGTTTGGGGAGAAATGGGCATTTGTTCAATTACCTTACTCA
GCTGTTAGAGAGGAGATCTCAGATTTTGATGAGAAGTTTGTGTTTGGTGCTAGCTTAGACTTGGATTTACTTGGCATTGA
AGTGGATGAGAATACTCTGATTCCTGGTCTCTCTGTTGCTACTTCACGTGCCAAACCTCTAGCAGCTTGGATGAATGGGC
TTGAAGTATGTTCGATTGAAGCAGACAGTTCCAAAGGATGTTTGATTCTATCAGTTGGGATCGCTACAAGGTATGTCTAC
GCGACCTATAAGAAGACCCCTGTCACTACTGATGAAGCTGAAGCTTGGGAATCTGCAAAGAAAACAAGTGGAGGTTTGCA
TTTTCTTGCAATTCAAGATGACTTAGATTCTGATGACTGTGTTGGCTTTTGGCTTCTTATTGATTTGCCACCACCCCCTG
TTTGA