Details for Arabidopsis Locus AT3G08000

Position : Chr3 ( 5`- 2554829 .. 2555929 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G08000

Protein [Map View]
MMKNGIELLVRRVSAIPQHSISSSFHFLPQFCTSSSASPSSKLFIGGLSWSVDEQSLKDAFSSFGEVAEVRIAYDKGSGR
SRGFGFVDFAEEGDALSAKDAMDGKGLLGRPLRISFALERVRGGPVVVPRLGKSKRERERVFK*

DNA
ATGATGAAAAATGGTATTGAGCTATTAGTGAGACGAGTTTCAGCGATACCTCAACACTCTATTTCTTCTAGCTTCCATTT
TCTTCCTCAATTTTGCACTTCTTCTTCTGCATCGCCCAGTTCCAAGCTATTCATCGGAGGATTGTCCTGGTCTGTGGATG
AGCAATCTCTCAAAGACGCTTTCTCTTCCTTTGGAGAGGTTGCAGAAGTTAGGATTGCGTATGACAAAGGAAGTGGGAGA
TCAAGAGGATTTGGTTTTGTTGATTTTGCAGAAGAAGGTGATGCTCTATCTGCAAAAGACGCCATGGATGGAAAGGGATT
ATTGGGTCGACCGTTGAGGATAAGTTTTGCCCTTGAAAGAGTGCGTGGTGGTCCTGTGGTTGTTCCACGTCTTGGGAAAT
CGAAGAGAGAAAGAGAAAGAGTCTTCAAGTGA