Details for Arabidopsis Locus AT3G07980

Position : Chr3 ( 5`- 2543616 .. 2551225 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07980

Protein [Map View]
MARQMTSSQFHKSKTLDNKYMLGDEIGKGAYGRVYIGLDLENGDFVAIKQVSLENIGQEDLNTIMQEIDLLKNLNHKNIV
KYLGSLKTKTHLHIILEYVENGSLANIIKPNKFGPFPESLVTVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKL
ADFGVATKLNEADFNTHSVVGTPYWMAPEVIELSGVCAASDIWSVGCTIIELLTCVPPYYDLQPMPALYRIVQDDTPPIP
DSLSPDITDFLRLCFKKDSRQRPDAKTLLSHPWIRNSRRALRSSLRHSGTIRYMKETDSSSEKDAEGSQEVVESVSAEKV
EVTKTNSKSKLPVIGGASFRSEKDQSSPSDLGEEGTDSEDDINSDQGPTLSMHDKSSRQSGTCSISSDAKGTSQDVLENH
EKYDRDEIPGNLETEASEGRRNTLATKLVGKEYSIQSSHSFSQKGEDGLRKAVKTPSSFGGNELTRFSDPPGDASLHDLF
HPLDKVPEGKTNEASTSTPTANVNQGDSPVADGGKNDLATKLRARIAQKQMEGETGHSQDGGDLFRLMMGVLKDDVLNID
DLVFDEKVPPENLFPLQAVEFSRLVSSLRPDESEDAIVTSSLKLVAMFRQRPGQKAVFVTQNGFLPLMDLLDIPKSRVIC
AVLQLINEIVKDNTDFLENACLVGLIPLVMSFAGFERDRSREIRKEAAYFLQQLCQSSPLTLQMFISCRGIPVLVGFLEA
DYAKHREMVHLAIDGMWQVFKLKKSTSRNDFCRIAAKNGILLRLVNTLYSLSEATRLASISGDALILDGQTPRARSGQLD
PNNPIFSQRETSPSVIDHPDGLKTRNGGGEEPSHALTSNSQSSDVHQPDALHPDGDRPRLSSVVADATEDVIQQHRISLS
ANRTSTDKLQKLAEGASNGFPVTQPDQVRPLLSLLEKEPPSRKISGQLDYVKHIAGIERHESRLPLLYASDEKKTNGDLE
FIMAEFAEVSGRGKENGNLDTAPRYSSKTMTKKVMAIERVASTCGIASQTASGVLSGSGVLNARPGSTTSSGLLAHALSA
DVSMDYLEKVADLLLEFARAETTVKSYMCSQSLLSRLFQMFNRVEPPILLKILECTNHLSTDPNCLENLQRADAIKQLIP
NLELKEGPLVYQIHHEVLSALFNLCKINKRRQEQAAENGIIPHLMLFVMSDSPLKQYALPLLCDMAHASRNSREQLRAHG
GLDVYLSLLDDEYWSVIALDSIAVCLAQDVDQKVEQAFLKKDAIQKLVNFFQNCPERHFVHILEPFLKIITKSSSINKTL
ALNGLTPLLIARLDHQDAIARLNLLKLIKAVYEKHPKPKQLIVENDLPQKLQNLIEERRDGQRSGGQVLVKQMATSLLKA
LHINTIL*

DNA
ATGGCGCGACAGATGACGTCATCCCAGTTCCACAAATCAAAGACTCTCGACAACAAATACATGCTAGGAGATGAAATTGG
TAAAGGAGCTTATGGTCGAGTTTATATAGGATTAGACTTGGAGAATGGAGACTTTGTTGCCATTAAACAAGTCTCTTTGG
AAAACATTGGTCAAGAGGATCTTAACACCATAATGCAAGAAATCGATCTCCTAAAGAACTTGAACCATAAAAACATTGTC
AAGTATCTCGGATCGTTGAAGACAAAGACTCACCTTCACATTATTCTGGAGTACGTTGAGAATGGCTCTCTTGCAAACAT
TATTAAACCTAATAAATTTGGACCTTTCCCAGAGTCGTTGGTGACTGTTTACATTGCACAGGTCTTGGAAGGTTTAGTAT
ATCTTCATGAGCAGGGTGTCATACATCGTGATATCAAGGGTGCAAATATTTTGACAACCAAGGAGGGCCTTGTTAAGCTT
GCTGATTTTGGAGTTGCCACAAAACTCAACGAGGCTGATTTTAACACTCACTCAGTGGTCGGAACTCCTTACTGGATGGC
TCCTGAGGTTATTGAATTGTCAGGAGTTTGTGCTGCTTCTGACATTTGGAGTGTTGGATGCACTATTATTGAACTTTTGA
CTTGTGTACCTCCTTACTATGATCTGCAACCCATGCCAGCCCTCTATCGCATTGTTCAGGATGATACCCCTCCTATTCCT
GATAGTCTTTCTCCTGATATTACAGACTTCCTAAGACTGTGCTTCAAGAAGGATTCCAGGCAGAGGCCTGATGCGAAGAC
ACTTCTCTCTCACCCTTGGATACGTAACTCGAGACGAGCATTGCGGTCATCGCTTCGGCATAGTGGAACCATCAGATATA
TGAAGGAAACCGATTCAAGTTCAGAGAAGGATGCTGAAGGTAGTCAAGAAGTAGTTGAAAGCGTTTCAGCAGAAAAAGTA
GAGGTGACAAAAACTAACTCGAAAAGCAAATTACCTGTTATAGGTGGGGCGAGTTTTAGGTCTGAGAAAGATCAATCTTC
ACCCAGTGATCTTGGTGAAGAAGGAACGGATTCAGAAGATGATATCAATTCAGATCAAGGTCCTACATTGTCTATGCACG
ATAAGTCTTCTCGTCAATCCGGTACTTGCAGTATTTCTTCGGATGCAAAGGGGACATCTCAAGATGTATTAGAGAACCAT
GAGAAATATGATCGTGATGAAATACCTGGAAATCTTGAAACGGAAGCTTCTGAAGGTAGAAGGAATACTTTAGCAACAAA
GCTGGTTGGAAAAGAATATTCTATCCAGTCATCACATAGTTTTAGCCAAAAAGGTGAAGATGGGCTTAGAAAGGCTGTGA
AGACTCCATCTAGTTTTGGTGGGAATGAACTGACCAGATTCAGTGATCCTCCTGGGGATGCTTCTTTGCATGATTTATTT
CATCCACTGGATAAAGTTCCTGAGGGAAAAACAAATGAAGCCTCAACATCGACGCCTACTGCAAATGTAAATCAGGGTGA
TTCTCCTGTTGCAGATGGTGGAAAGAATGATCTGGCAACGAAATTGAGGGCTAGAATTGCTCAGAAGCAAATGGAGGGTG
AAACGGGGCACTCACAAGATGGTGGTGATCTTTTCCGCTTAATGATGGGTGTTTTGAAAGATGATGTCCTTAACATCGAT
GACTTGGTATTTGATGAAAAAGTTCCCCCGGAGAATCTTTTTCCTCTGCAGGCAGTCGAGTTCAGCAGATTGGTGAGCTC
CTTAAGGCCAGATGAATCAGAAGATGCAATAGTAACTTCCTCTTTGAAACTTGTTGCCATGTTTCGTCAGAGACCTGGGC
AGAAAGCAGTATTTGTGACACAGAATGGTTTCCTCCCTCTAATGGATCTACTCGATATTCCTAAATCTCGAGTAATATGT
GCCGTGCTGCAGCTGATAAATGAAATTGTAAAAGATAATACCGACTTCCTGGAAAATGCTTGTCTTGTTGGTCTTATTCC
TTTGGTAATGAGTTTTGCTGGTTTTGAGAGGGATCGATCACGAGAAATTCGTAAGGAAGCAGCCTACTTCTTGCAGCAGC
TTTGTCAGTCAAGCCCCTTGACGTTGCAAATGTTCATATCTTGCCGTGGAATACCCGTTTTGGTGGGATTTCTTGAAGCA
GACTATGCCAAACACAGGGAGATGGTTCACTTGGCTATTGATGGGATGTGGCAGGTATTTAAACTCAAAAAATCCACCTC
GAGAAATGATTTTTGCCGTATTGCTGCAAAGAATGGAATTCTTCTTAGGCTAGTCAACACTCTTTATAGCTTGAGTGAGG
CAACTCGACTGGCTTCTATATCGGGGGATGCATTGATTTTGGATGGTCAAACTCCACGAGCACGCTCTGGTCAACTTGAC
CCTAACAATCCTATCTTTAGTCAGCGTGAGACTTCACCTAGTGTGATTGATCATCCTGATGGGTTGAAAACTAGGAATGG
GGGTGGTGAAGAGCCTTCTCATGCTTTAACTTCAAATTCTCAAAGTTCAGATGTCCATCAACCCGATGCCTTGCACCCAG
ATGGTGATAGGCCTAGATTAAGCAGTGTTGTAGCAGATGCCACAGAGGATGTTATACAACAACATAGGATATCTCTTTCT
GCCAATAGAACATCAACAGATAAGCTTCAGAAACTGGCGGAGGGTGCGTCTAATGGTTTTCCTGTTACTCAGCCAGATCA
AGTTCGACCTTTGCTTAGCTTATTGGAGAAAGAACCTCCTTCAAGAAAAATTTCTGGTCAACTGGATTACGTAAAGCATA
TCGCTGGCATAGAGAGGCATGAAAGTAGACTTCCTCTTTTGTATGCATCAGACGAAAAGAAAACCAATGGAGACCTAGAA
TTTATAATGGCTGAATTTGCAGAAGTCTCTGGACGTGGAAAGGAAAACGGAAATCTTGATACTGCGCCAAGATATTCCAG
CAAGACGATGACTAAGAAGGTTATGGCTATTGAGAGAGTCGCATCTACGTGTGGGATTGCATCTCAGACAGCATCTGGTG
TTCTGTCAGGTTCGGGTGTTTTAAATGCTAGACCTGGAAGTACCACATCATCTGGTTTACTTGCCCATGCGCTGAGTGCA
GATGTCTCAATGGATTACTTGGAGAAAGTGGCTGATCTGCTTCTTGAATTTGCCCGAGCTGAAACGACAGTAAAATCATA
CATGTGCAGCCAAAGTTTACTCAGTCGTCTTTTCCAGATGTTCAACCGTGTGGAACCTCCTATTCTGTTAAAGATACTGG
AATGCACCAATCATTTATCCACGGATCCAAATTGCTTGGAAAATCTTCAGCGTGCAGATGCAATCAAGCAATTGATCCCC
AACCTTGAGCTTAAGGAAGGGCCTCTTGTTTATCAGATCCATCATGAGGTACTTAGTGCACTATTCAACCTCTGCAAGAT
AAACAAGAGGAGGCAGGAACAAGCTGCTGAAAATGGAATCATTCCGCACCTGATGCTTTTCGTCATGTCGGATTCTCCTC
TGAAACAATATGCATTGCCACTACTTTGTGATATGGCTCATGCATCTCGGAATTCAAGAGAGCAGTTAAGGGCCCACGGC
GGTCTGGATGTTTACCTGAGTTTACTCGATGATGAATATTGGTCCGTGATAGCCTTGGATTCAATTGCTGTTTGCTTGGC
GCAAGACGTTGACCAAAAGGTGGAGCAGGCGTTTCTCAAGAAAGATGCAATTCAGAAATTAGTTAACTTTTTCCAGAACT
GTCCAGAGAGACATTTTGTGCACATTTTGGAGCCATTCTTGAAGATCATCACGAAATCATCTTCAATCAATAAGACATTA
GCGTTAAATGGACTGACTCCGTTACTCATTGCAAGACTAGACCACCAAGATGCTATTGCTCGACTTAACCTCCTGAAACT
CATCAAGGCCGTTTACGAGAAGCATCCGAAGCCAAAACAGCTGATCGTAGAGAACGATCTTCCACAAAAACTGCAGAATC
TGATAGAAGAACGACGTGATGGACAACGTTCAGGAGGCCAAGTTCTGGTGAAGCAAATGGCAACATCTCTCCTCAAAGCA
CTTCACATCAACACCATCTTGTGA