Details for Arabidopsis Locus AT3G07910

Position : Chr3 ( 5`- 2523157 .. 2524165 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07910

Protein [Map View]
MAKNSCLAKITAGVAVGGALGGAVGAVYGTYEAIRVKVPGLHKVRFIGQTTLSSAAIFGLFLGAGSLIHCGKGY*

DNA
ATGGCGAAAAATAGCTGTTTGGCCAAAATCACTGCCGGAGTTGCCGTTGGCGGCGCTCTTGGCGGCGCAGTAGGTGCTGT
CTATGGAACTTACGAGGCGATTAGAGTCAAGGTTCCGGGGCTTCATAAGGTTAGATTCATTGGGCAAACTACCCTCAGCA
GCGCAGCAATTTTCGGGCTTTTTCTAGGTGCGGGCAGTTTGATTCACTGTGGAAAAGGCTACTGA