Details for Arabidopsis Locus AT3G07900

Position : Chr3 ( 5`- 2520774 .. 2523108 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07900

Protein [Map View]
MGTWKNKNSNKKNRVSYISVPAQIINSVSSSSLHKFLDNKSSKKNTSKFFFNLRNPKLWAFSLFLLSILGISLRLGLCLS
HFGSGDHESQLQSSDSNGSPKSHMGFAYIRSSTTQVEISNAKDRSLDMGVEKNETFGGHQSHLIIPNGNGHDDKNYDFWK
QPDGLGYKPCLDFSIEYRRESKKILVERRKYLMVVVSGGLNQQKIQIVDAVVIARILGAVLVVPILQINLIWGDESEFSD
IFDLEQFKSVLANDVKIVSLLPASKVMTRPSEDGSMPFNASPQWIRSHYPKRFNREGVLLLRRLDSRLSKDLPSDLQKLR
CKVAFEALKFSPRVMEMGTKLAERMRSKGPYIALHLRMEKDVWVRTGCLSGLSSKYDEIVNIERIKRPELLTAKSSMTSN
ERKLAGLCPLNAKEVTRLLRALGAPRDARIYWAGGEPLGGKEALKPLTSEFPHLYNKYDIALPLELKPFAKRASIMAAID
YIVCKESDVFMASHGGNMGHAIQGHRAYEGHKKIITPNKRHMLPYFVNSSLTETEFEKMIKKLHRQSLGQPELRISKAGR
DVTKYPVPECMCNQSNTTI*

DNA
ATGGGAACATGGAAGAACAAAAACAGTAATAAGAAGAACAGAGTTAGCTACATTTCAGTCCCAGCTCAGATCATAAACTC
AGTTTCATCATCATCTTTACACAAATTTCTCGATAATAAATCTTCAAAGAAGAACACAAGCAAGTTCTTCTTCAATCTCA
GAAACCCAAAGCTCTGGGCTTTCTCTCTCTTCTTACTTTCTATTTTGGGGATATCATTAAGACTCGGTCTTTGTCTTTCT
CATTTCGGTTCTGGCGATCACGAAAGTCAACTTCAGAGTTCAGATTCTAATGGCTCGCCCAAATCCCATATGGGTTTTGC
GTATATCCGATCAAGCACTACTCAAGTTGAGATTTCAAACGCAAAGGATCGATCTTTAGATATGGGAGTGGAGAAAAATG
AAACCTTTGGTGGTCACCAATCACATTTGATCATCCCTAATGGAAATGGACATGATGATAAGAATTATGACTTCTGGAAA
CAGCCTGATGGATTAGGTTACAAGCCTTGCTTAGATTTCAGCATTGAATACAGAAGAGAGAGTAAGAAGATTCTTGTAGA
GAGGAGAAAGTATCTGATGGTGGTTGTCTCTGGTGGGTTGAATCAGCAGAAGATTCAGATTGTTGATGCAGTTGTGATTG
CGAGGATTCTAGGTGCTGTTCTTGTTGTCCCAATATTGCAAATCAATCTCATTTGGGGTGACGAGAGCGAGTTTTCAGAT
ATATTTGATTTAGAGCAATTCAAGAGTGTTTTAGCAAATGATGTGAAGATTGTTTCGTTGCTTCCCGCAAGTAAAGTAAT
GACTAGACCATCGGAAGATGGTAGTATGCCCTTTAATGCCTCCCCTCAATGGATCCGTTCGCACTATCCAAAGCGTTTCA
ATAGGGAAGGTGTTCTGCTTTTAAGGAGATTGGATTCAAGATTGTCTAAAGACTTACCCTCTGATCTCCAGAAGCTCCGT
TGTAAGGTAGCATTTGAAGCTCTAAAGTTTTCGCCACGAGTTATGGAAATGGGGACGAAGCTTGCAGAGAGGATGAGGAG
CAAAGGGCCTTACATTGCGTTGCATCTTCGGATGGAGAAAGATGTGTGGGTGAGAACAGGCTGCCTTTCTGGTTTGAGCT
CAAAGTATGATGAGATTGTGAACATTGAAAGGATTAAGCGGCCTGAGCTCTTAACAGCCAAATCTAGTATGACATCTAAC
GAGAGAAAACTCGCGGGTCTCTGTCCGTTAAATGCCAAGGAAGTAACAAGGCTGCTTAGAGCTCTTGGAGCACCAAGAGA
TGCGAGGATCTATTGGGCGGGAGGGGAACCGCTCGGTGGAAAGGAAGCTTTGAAACCGTTAACAAGTGAATTCCCACATC
TCTACAACAAGTACGATATTGCGTTGCCTCTTGAACTCAAACCTTTCGCAAAACGAGCTTCGATAATGGCAGCAATCGAC
TATATAGTGTGTAAGGAGAGTGATGTGTTTATGGCATCTCATGGAGGGAACATGGGCCACGCAATTCAGGGGCACAGGGC
TTATGAAGGACACAAGAAGATTATAACGCCAAACAAAAGACATATGCTACCATACTTTGTGAACTCATCATTGACTGAAA
CAGAGTTTGAGAAGATGATAAAGAAATTACACAGACAATCTCTAGGACAGCCAGAACTAAGGATTAGCAAAGCTGGAAGA
GATGTTACAAAGTACCCTGTTCCTGAGTGTATGTGCAATCAATCCAACACCACTATTTAG