Details for Arabidopsis Locus AT3G07890

Position : Chr3 ( 5`- 2516304 .. 2519375 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07890

Protein [Map View]
MFGIQSRRDLTMELQSQIPILRPSIHARRANIVVKFQDLYGFTVEGNVDDVNVLNEVREKVRNQGRVWWALEASKGANWY
LQPEILLIGDGIALKTSLKLSTLTNAITLKRLIRKGIPPVLRPKVWFSLSGAAKKKSTVPESYYSDLTKAVEGMVTPATR
QIDHDLPRTFPGHPWLDTPEGHAALRRVLVGYSFRDSDVGYCQGLNYVAALLLLVMKTEEDAFWMLAVLLENVLVRDCYT
TNLSGCHVEQRVFKDLLAQKCSRIATHLEDMGFDVSLVATEWFLCLFSKSLPSETTLRVWDVLFYEGAKVLFHAALAIFK
MKENELLMTHQVGDVINILQKTSHQLFDPDELLTVAFEKIGSMTTNTISKQRKKQEPAVMAELDQRLRRLNSLKESGKST
*

DNA
ATGTTTGGGATCCAAAGCAGACGTGATTTAACGATGGAGCTACAATCTCAGATTCCGATTCTCCGTCCAAGCATCCACGC
AAGACGAGCCAACATCGTCGTTAAATTCCAGGACTTGTACGGGTTCACGGTGGAAGGAAATGTCGACGACGTTAATGTGT
TGAACGAGGTTAGAGAGAAAGTCAGGAATCAAGGACGAGTTTGGTGGGCTCTTGAAGCTAGCAAAGGAGCTAATTGGTAT
CTTCAGCCGGAGATTCTCTTGATCGGTGACGGTATCGCTTTGAAAACTTCTCTCAAGCTCTCCACTTTGACTAATGCGAT
TACGTTGAAGAGATTGATTCGGAAAGGGATCCCTCCTGTGCTTAGACCTAAGGTTTGGTTTTCTCTTTCTGGTGCTGCTA
AGAAGAAATCCACCGTCCCAGAGAGTTATTATAGTGATTTGACCAAAGCCGTCGAAGGGATGGTCACGCCGGCTACGAGG
CAGATTGATCATGATCTGCCACGTACTTTCCCAGGCCATCCATGGTTGGACACTCCAGAAGGTCATGCTGCTCTACGACG
TGTGCTTGTTGGGTATTCCTTTCGTGATTCAGATGTTGGCTATTGTCAGGGTCTAAACTACGTTGCAGCGTTACTATTAC
TTGTCATGAAGACAGAAGAAGACGCATTCTGGATGCTAGCGGTCCTTTTGGAAAACGTATTAGTCCGTGATTGTTACACA
ACCAACTTATCTGGATGTCATGTTGAGCAGCGGGTTTTCAAAGATTTGCTTGCCCAAAAATGTTCTCGAATAGCTACTCA
TCTTGAAGATATGGGCTTTGATGTTTCCCTTGTAGCCACTGAATGGTTTCTATGCCTCTTCTCTAAAAGCCTTCCTTCAG
AGACAACTCTAAGGGTGTGGGATGTACTTTTCTATGAAGGAGCGAAGGTTCTATTCCATGCAGCTTTAGCAATATTCAAG
ATGAAAGAGAACGAGCTGCTTATGACCCACCAGGTCGGCGATGTTATCAACATATTACAGAAAACTTCACACCAGCTTTT
TGACCCGGATGAATTATTAACGGTGGCATTTGAGAAAATCGGATCAATGACTACCAACACGATATCAAAGCAGAGGAAGA
AGCAGGAACCAGCAGTGATGGCAGAACTTGACCAGAGACTTCGGAGACTTAACTCTCTTAAAGAAAGTGGGAAGAGCACA
TAA