Details for Arabidopsis Locus AT3G07880

Position : Chr3 ( 5`- 2513971 .. 2515823 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07880

Protein [Map View]
MSLVSGARDMGFDDNNNNKNNKDGDDENSSSRTRADDDALSRQMSESSLCATEEEEDDDSKLQLGPQYTIKEHLEKDKDD
ESLRKWKEQLLGSVDVTNIGETLDPEVRIDSLAIISPGRPDIVLLVPENGNPKGMWFTLKEGSKYNLKFTFHVNNNIVSG
LRYTNTVWKTGVKVDRAKEMLGTFSPQLEPYNHVMPEETTPSGMFARGSYSARTKFLDDDNKCYLEINYSFDIRKEWPAL
*

DNA
ATGTCTTTGGTATCTGGAGCCAGGGACATGGGGTTCGACGACAACAACAACAACAAGAACAACAAGGATGGAGATGATGA
GAACTCCTCCTCCAGAACAAGAGCCGACGACGATGCTCTTAGTCGACAGATGAGCGAATCTTCTCTTTGTGCTACCGAGG
AGGAAGAAGACGACGATTCCAAATTGCAATTGGGTCCTCAGTACACTATCAAAGAACATCTCGAGAAGGACAAGGATGAT
GAGAGTCTGAGGAAATGGAAGGAACAGCTTCTCGGAAGTGTTGATGTCACCAACATTGGAGAGACTCTTGATCCGGAAGT
GAGGATTGATAGCCTCGCCATCATATCTCCTGGAAGACCCGACATTGTTCTCTTGGTTCCTGAGAATGGAAATCCAAAGG
GCATGTGGTTTACTTTGAAAGAAGGGAGCAAGTACAACTTGAAATTCACTTTTCATGTTAACAACAACATTGTCTCTGGT
CTTAGGTACACCAATACAGTTTGGAAGACCGGTGTCAAAGTGGACAGAGCTAAGGAAATGCTTGGAACCTTTAGTCCTCA
GTTGGAGCCATACAACCACGTGATGCCAGAAGAGACCACTCCTTCTGGCATGTTTGCTCGAGGATCATATTCTGCAAGAA
CTAAGTTTCTTGATGATGATAATAAGTGCTACTTGGAGATCAACTACAGCTTTGACATCCGTAAAGAATGGCCTGCGCTT
TGA