Details for Arabidopsis Locus AT3G07850

Position : Chr3 ( 5`- 2505547 .. 2507528 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07850

Protein [Map View]
MVGSHKASGVLLVLLVVMATTIANGTPVVDKAKNAATAVEDTAKNAATAVGGAAASVGAKVSGAKPGAAVDVKASGAKGD
SKTDDSAAFAAAWKEACAAGSTITVPKGEYMVESLEFKGPCKGPVTLELNGNFKAPATVKTTKPHAGWIDFENIADFTLN
GNKAIFDGQGSLAWKANDCAKTGKCNSLPINIRFTGLTNSKINSITSTNSKLFHMNILNCKNITLSDIGIDAPPESLNTD
GIHIGRSNGVNLIGAKIKTGDDCVSIGDGTENLIVENVECGPGHGISIGSLGRYPNEQPVKGVTVRKCLIKNTDNGVRIK
TWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPYGHCKAGVPSQVKLSDVTIKGIKGTSATKVAVKLMCSKGVPCTNI
ALSDINLVHNGKEGPAVSACSNIKPILSGKLVPAACTEVAKPGP*

DNA
ATGGTGGGTTCTCACAAAGCAAGCGGAGTGCTTCTTGTGCTACTAGTGGTTATGGCCACCACAATAGCAAACGGGACACC
GGTTGTCGATAAAGCAAAAAATGCAGCTACAGCAGTTGAAGATACAGCAAAAAATGCAGCTACAGCAGTTGGCGGTGCAG
CTGCATCAGTTGGTGCTAAAGTATCAGGTGCCAAACCAGGCGCAGCAGTTGATGTTAAAGCATCAGGAGCCAAAGGAGAC
AGCAAAACTGATGATAGTGCGGCATTTGCGGCTGCATGGAAAGAAGCTTGTGCAGCAGGGAGCACAATTACAGTGCCAAA
AGGTGAGTATATGGTAGAGAGCCTAGAGTTCAAAGGTCCATGCAAAGGTCCAGTCACTTTGGAATTGAATGGCAATTTCA
AGGCTCCGGCTACGGTCAAGACCACTAAGCCACATGCCGGATGGATTGATTTCGAAAATATAGCTGATTTCACTTTGAAT
GGAAACAAAGCTATTTTTGACGGTCAAGGGTCCCTCGCTTGGAAGGCCAATGATTGTGCCAAAACTGGCAAATGCAACTC
TCTCCCTATCAACATCCGATTCACTGGTCTAACAAACTCAAAGATTAATAGTATTACATCAACAAACAGCAAACTTTTCC
ACATGAACATCCTTAACTGCAAGAACATTACTCTTTCGGATATTGGTATTGATGCACCTCCGGAGAGTCTCAACACCGAT
GGTATCCACATCGGAAGGTCCAATGGAGTCAACTTAATTGGGGCAAAGATCAAAACCGGAGATGACTGCGTTTCCATTGG
AGATGGTACCGAAAATCTCATTGTTGAGAACGTAGAATGTGGACCAGGACACGGAATTTCCATTGGAAGTCTTGGAAGAT
ACCCTAATGAGCAACCAGTAAAAGGAGTCACCGTGAGGAAATGCCTCATCAAGAACACTGACAATGGTGTTCGCATCAAG
ACATGGCCAGGATCTCCCCCCGGCATCGCCTCCAACATTCTTTTCGAAGATATCACAATGGACAATGTTAGCCTTCCCGT
TCTCATCGACCAAGAGTACTGTCCTTATGGCCACTGCAAAGCTGGGGTACCATCGCAAGTGAAGTTGTCAGACGTGACTA
TCAAGGGCATTAAGGGTACATCAGCAACAAAGGTGGCTGTGAAGCTAATGTGCAGCAAAGGAGTGCCTTGCACCAATATT
GCTCTCTCTGACATCAACTTGGTCCACAACGGCAAAGAGGGACCAGCTGTCTCGGCATGTTCTAACATCAAGCCTATTCT
CAGCGGAAAGTTGGTTCCAGCGGCTTGCACTGAAGTTGCTAAACCGGGTCCATAA