Details for Arabidopsis Locus AT3G07810

Position : Chr3 ( 5`- 2492273 .. 2495750 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07810

Protein [Map View]
MQSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVAEIVITEKHNIDGRLVEAKKA
VPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEE
AVEKVLLKTFHELNGKMVEVKRAVPKELSPGPSRSPLGAGYSYGVNRVNNLLNGYAQGFNPAAVGGYGLRMDGRFSPVGA
GRSGFANYSSGYGMNVNFDQGLPTGFTGGTNYNGNVDYGRGMSPYYIGNTNRFGPAVGYEGGNGGGNSSFFSSVTRNLWG
NNGGLNYNNNNTNSNSNTYMGGSSSGNNTLSGPFGNSGVNWGAPGGGNNAVSNENVKFGYGGNGESGFGLGTGGYAARNP
GANKAAPSSSFSSASATNNTGYDTAGLAEFYGNGAVYSDPTWRSPTPETEGPAPFSYGIGGGVPSSDVSARSSSPGYVGS
YSVNKRQPNRGEPSR*

DNA
ATGCAATCGGATAATGGAAAGCTTTTCATCGGTGGGATATCTTGGGACACCAATGAGGAACGTCTCAAGGAGTATTTCAG
CAGTTTTGGAGAAGTGATCGAAGCTGTCATCTTGAAAGATCGTACCACTGGTCGTGCTCGTGGTTTCGGTTTTGTTGTTT
TTGCTGATCCTGCTGTTGCTGAGATTGTTATCACCGAAAAACATAATATTGATGGCAGATTGGTTGAAGCCAAGAAAGCT
GTTCCCAGAGATGACCAAAACATGGTAAATAGAAGCAACAGCAGTAGCATCCAAGGTTCTCCCGGTGGTCCAGGTCGCAC
AAGGAAGATATTTGTTGGAGGATTACCTTCTTCGGTTACAGAGAGTGATTTCAAGACGTATTTTGAGCAGTTTGGTACAA
CTACGGATGTGGTTGTCATGTATGATCACAACACACAAAGGCCTAGAGGTTTCGGGTTTATAACCTACGATTCCGAGGAG
GCGGTTGAAAAGGTATTGCTCAAGACATTCCATGAACTAAATGGTAAAATGGTTGAGGTTAAGCGAGCTGTTCCAAAGGA
GTTATCTCCAGGTCCAAGTCGCAGTCCTCTTGGTGCAGGTTACAGCTATGGAGTTAATAGGGTCAATAACCTCCTTAATG
GGTATGCTCAAGGGTTTAATCCCGCTGCAGTTGGAGGCTACGGACTTAGGATGGATGGTCGGTTCAGTCCGGTTGGTGCT
GGAAGAAGCGGGTTTGCAAATTACAGTTCTGGATACGGGATGAATGTGAACTTTGATCAGGGATTGCCCACAGGGTTCAC
GGGAGGTACAAATTACAATGGAAATGTTGACTATGGCCGAGGAATGAGCCCGTACTACATTGGTAACACAAACAGGTTTG
GTCCTGCGGTTGGCTATGAAGGGGGCAACGGAGGAGGAAACTCATCCTTCTTCAGTTCGGTTACACGGAACTTATGGGGA
AACAATGGTGGTCTTAACTATAACAACAATAATACAAACTCAAACTCCAATACATATATGGGAGGATCATCAAGTGGGAA
CAACACACTTAGTGGTCCATTTGGAAATTCAGGAGTCAATTGGGGTGCTCCTGGAGGAGGAAACAATGCTGTGAGTAACG
AGAATGTGAAGTTTGGTTATGGAGGAAACGGTGAATCTGGTTTTGGGTTGGGAACAGGTGGTTATGCAGCAAGAAACCCA
GGGGCTAACAAGGCAGCACCATCCTCTTCATTCTCTTCTGCCTCAGCAACCAACAACACGGGTTATGATACAGCAGGACT
TGCAGAGTTTTACGGGAATGGTGCAGTTTATAGTGACCCTACATGGAGATCACCAACTCCTGAGACAGAAGGGCCTGCTC
CTTTTAGCTATGGGATTGGAGGAGGGGTTCCTTCTTCAGATGTTTCAGCTAGAAGTTCATCTCCAGGTTATGTTGGCAGT
TACAGTGTGAACAAGAGACAACCAAACAGAGGCGAGCCATCACGGTGA