Details for Arabidopsis Locus AT3G07800

Position : Chr3 ( 5`- 2489387 .. 2491087 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07800

Protein [Map View]
MATLKASFLIKTLDSDVTGDFLSDLERRGSGAVHVIMGPMFSGKSTSLLRRIKSEISDGRSVAMLKSSKDTRYAKDSVVT
HDGIGFPCWALPDLMSFPEKFGLDAYNKLDVIGIDEAQFFGDLYEFCCKVADDDGKIVIVAGLDGDYLRRSFGAVLDIIP
IADSVTKLTARCEVCGHKAFFTLRKNCDTRTELIGGADVYMPVCRKHYITNHIVIKASKKVLEDSDKARAESCVAATI*

DNA
ATGGCGACTCTCAAAGCTTCCTTTTTGATCAAAACCCTCGACAGTGACGTCACCGGAGATTTTCTCTCCGATCTGGAACG
TCGTGGGTCAGGTGCTGTTCATGTTATCATGGGTCCTATGTTTTCTGGGAAATCGACCTCTCTCCTTCGCCGAATCAAGT
CAGAGATCAGCGACGGAAGAAGTGTTGCGATGCTGAAATCGAGTAAGGATACGAGATACGCAAAAGATTCGGTGGTGACA
CATGATGGAATTGGATTCCCTTGCTGGGCTCTTCCAGATCTCATGTCATTTCCTGAGAAATTCGGACTAGATGCTTATAA
CAAGCTTGATGTGATTGGTATTGATGAGGCTCAGTTCTTTGGAGATCTTTATGAGTTTTGCTGCAAAGTCGCTGATGATG
ATGGTAAAATTGTGATCGTTGCTGGCCTAGATGGTGACTATTTAAGGAGGAGTTTTGGGGCTGTACTTGACATTATACCA
ATAGCTGATTCTGTGACTAAGCTAACTGCAAGGTGTGAGGTCTGTGGACATAAAGCTTTCTTCACTTTAAGAAAGAATTG
TGACACCAGAACTGAGCTTATTGGTGGAGCTGATGTCTATATGCCTGTTTGTCGCAAGCATTACATCACTAATCATATTG
TTATTAAAGCCTCTAAGAAAGTCTTGGAAGATTCTGACAAGGCTAGAGCTGAATCCTGTGTTGCTGCTACAATCTAA