Details for Arabidopsis Locus AT3G07780

Position : Chr3 ( 5`- 2484469 .. 2487024 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07780

Protein [Map View]
MGTSSGSNLPHQMLPPRQQLQTSLSLVSSDPHLSRSNSGIVRESPAESASSQETWPTSKSIMGRKTDSGKTGPDSHDQHV
IRHVSIADKVSLRDIARERLDIVAERMHRLPEEYLEELKNGLKAILEGNGAQPIDEFMFLQKFVQTRSDLTSKTLVRAHR
VQLEVLVVINTGIQAFLHPNINLSQSSLIEIFVYKRCRNIACQNELPADGCPCEICANRKGFCNLCMCVICNKFDFAVNT
CRWIGCDVCSHWTHTDCAIRDGEISMGVSPKSVSGMGEMLFKCRACNHTSELLGWVKDVFQHCAPNWDRESLMKELDFVS
RIFRGSEDTRGRKLFWKCEELMEKIKGGLAEATAAKLILMFFQEIELDSPKSLESGEGGGTIAPQDACNRIAEVVKETLR
KMEIVGEEKTRMYKKARMGLEECEREVEEKAKQVAELQMERQKKKQQIEEVERIVRLKQAEAEMFQLKANEAKVEAERLE
RIVKAKKEKTEEEYASNYLKLRLSEAEAEKEYLFEKIKEQESGGNGGEASQAVMYSKIREMLHGYNASSPRVDPRSNQRN
PFRSNP*

DNA
ATGGGCACATCATCTGGGTCCAATCTTCCTCACCAGATGCTACCTCCACGTCAGCAACTACAAACATCTCTTTCGCTTGT
ATCTTCAGATCCCCACTTGTCACGGTCTAATTCTGGCATTGTGCGTGAATCACCAGCTGAAAGTGCTAGCTCTCAAGAAA
CTTGGCCAACCTCAAAATCTATTATGGGAAGGAAGACAGATAGCGGAAAGACAGGGCCTGACTCTCATGATCAACATGTG
ATCCGCCATGTTTCCATTGCTGATAAGGTATCGCTACGGGACATAGCTAGAGAGAGACTTGACATAGTCGCTGAGAGAAT
GCATCGATTACCAGAAGAATATCTCGAGGAGTTAAAGAATGGTCTTAAGGCTATCCTTGAAGGAAATGGTGCGCAGCCTA
TAGATGAGTTTATGTTTCTGCAGAAGTTTGTCCAGACGAGATCTGATTTAACTTCAAAGACACTTGTCAGGGCTCACCGA
GTGCAGCTTGAAGTTCTTGTGGTTATAAACACTGGTATCCAAGCATTCTTGCACCCAAACATCAATCTCTCTCAGTCATC
ACTCATCGAGATCTTTGTGTACAAGAGATGCAGAAACATAGCTTGCCAAAACGAACTCCCGGCTGATGGTTGTCCCTGTG
AGATATGCGCTAATAGGAAAGGCTTCTGCAACCTGTGCATGTGTGTGATATGTAACAAGTTTGACTTTGCAGTCAACACA
TGCCGCTGGATTGGCTGCGACGTGTGTTCTCATTGGACTCATACGGATTGTGCTATTAGGGATGGGGAGATTTCGATGGG
AGTTTCTCCCAAGAGCGTATCTGGGATGGGAGAAATGCTGTTCAAGTGTCGAGCGTGCAACCATACTTCTGAATTGCTGG
GGTGGGTGAAAGATGTGTTTCAGCACTGTGCACCAAACTGGGATAGGGAATCTTTAATGAAGGAACTTGACTTCGTTAGT
AGGATTTTCCGTGGAAGCGAAGATACAAGAGGCCGGAAACTCTTCTGGAAGTGTGAGGAGCTTATGGAGAAGATTAAAGG
TGGACTGGCTGAAGCAACAGCGGCCAAGTTGATACTCATGTTTTTCCAAGAAATTGAATTGGACTCTCCAAAGAGCCTTG
AAAGCGGAGAAGGTGGGGGTACGATAGCACCTCAAGATGCATGCAACCGAATTGCTGAAGTTGTAAAGGAAACACTGAGG
AAAATGGAGATAGTGGGTGAGGAAAAGACGAGGATGTACAAGAAAGCGCGAATGGGGCTTGAGGAATGCGAGAGAGAGGT
AGAAGAGAAAGCAAAGCAAGTGGCGGAACTGCAGATGGAGAGGCAGAAGAAGAAACAACAGATAGAAGAGGTGGAGAGGA
TAGTGAGGCTGAAGCAAGCAGAGGCAGAGATGTTTCAGTTAAAAGCAAACGAGGCAAAAGTGGAAGCAGAGAGATTGGAA
AGGATTGTGAAAGCGAAAAAGGAGAAAACAGAAGAGGAATACGCAAGTAACTATTTGAAACTGAGGCTGAGCGAGGCGGA
GGCAGAGAAAGAGTATCTGTTTGAAAAGATAAAAGAGCAGGAAAGTGGTGGGAATGGTGGTGAAGCGTCACAAGCAGTGA
TGTACTCAAAGATCAGAGAAATGCTGCATGGATACAATGCATCGTCGCCAAGGGTAGATCCAAGATCAAACCAGCGAAAT
CCTTTCAGATCCAATCCTTAG