Details for Arabidopsis Locus AT3G07720

Position : Chr3 ( 5`- 2465365 .. 2467233 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07720

Protein [Map View]
MAATPMEGKWVQLKQKGTGPGARSSHAIALVGNKMYAFGGEFQPRVPVDNQLYVFDLETQTWSIQEASGDAPPPRVGVAM
AAVGPIIYFFGGRDSTHQELNELYCFNTLTNQWKLLSSGETGPQNRSYHSITADSQNVYVFGGCGVDGRLNDLWAYNVVD
QKWIKFPSPGEACRGRGGPGLEVVQGKIWVVYGFAGEEADDVHCFDIAKGEWKEVETKGEKPSARSVFSTAVVGKQILIS
GGEIDPSDLGHMGAGCFTGDAYGLDTETLEWRKWEDGVGSVEHPGPRGWCAFAAGSRDGKQGLLVYGGNSPSNDRLDDIF
FFTPNTLLK*

DNA
ATGGCAGCGACTCCAATGGAAGGCAAATGGGTTCAGCTTAAACAGAAAGGAACCGGACCAGGAGCAAGAAGCTCTCATGC
TATAGCTCTTGTGGGAAACAAAATGTATGCCTTTGGTGGCGAGTTTCAACCACGTGTTCCTGTTGACAACCAGCTCTACG
TTTTCGACCTCGAAACTCAGACATGGTCTATCCAGGAAGCTTCTGGGGATGCTCCTCCTCCTAGAGTAGGTGTAGCCATG
GCTGCAGTCGGACCCATCATCTATTTCTTTGGTGGCCGGGACTCGACTCACCAGGAGCTCAACGAGTTATACTGTTTTAA
CACTTTGACCAACCAGTGGAAACTACTCTCTTCAGGGGAAACCGGTCCACAGAACCGAAGCTACCACTCTATTACTGCGG
ATTCTCAGAACGTGTATGTGTTTGGTGGATGCGGAGTTGATGGGCGTCTCAACGATCTATGGGCTTACAATGTCGTTGAT
CAGAAATGGATTAAGTTCCCATCTCCGGGAGAAGCTTGTAGAGGAAGAGGCGGTCCAGGACTCGAGGTGGTTCAAGGAAA
GATCTGGGTGGTATATGGATTCGCAGGAGAAGAAGCAGACGATGTCCACTGTTTCGACATAGCTAAAGGGGAATGGAAAG
AAGTTGAGACAAAAGGCGAAAAACCGTCAGCAAGAAGTGTGTTTTCGACTGCGGTTGTTGGGAAACAGATACTGATATCT
GGAGGAGAGATTGACCCGAGCGATCTGGGGCATATGGGAGCAGGATGTTTCACAGGTGACGCTTATGGGCTTGATACAGA
GACGCTGGAATGGAGGAAATGGGAGGATGGGGTTGGATCGGTGGAGCATCCCGGTCCTAGAGGATGGTGCGCGTTTGCAG
CTGGATCACGAGATGGTAAGCAAGGTCTGTTGGTTTATGGCGGGAACTCGCCGAGCAATGATAGGCTTGATGATATCTTC
TTCTTCACTCCCAACACTCTACTCAAGTGA