Details for Arabidopsis Locus AT3G07710

Position : Chr3 ( 5`- 2464336 .. 2464773 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07710

Protein [Map View]
MENETGGKDREVVEAVTNSEPGNGDGFAKKGDSYDDKLPSENVDKHMENEANEKEKEEDGAADELCALQDALETTLFQHL
SNYAQKQMLQKLRSLRAKERKELSGEWKSLLAQEALLKSKKYSFSAELANATFHTWEEETRRMVL*

DNA
ATGGAGAATGAGACTGGTGGGAAGGATAGGGAGGTAGTTGAAGCAGTGACAAACAGTGAACCTGGAAATGGTGATGGATT
TGCAAAAAAAGGCGACTCTTATGATGACAAATTACCTTCTGAAAATGTTGACAAACATATGGAGAATGAGGCTAATGAGA
AGGAGAAGGAGGAAGATGGTGCTGCTGATGAGCTGTGCGCTTTACAGGATGCGCTTGAGACGACACTGTTTCAGCATTTA
AGCAACTATGCACAGAAGCAGATGTTACAGAAGTTGAGGAGCCTTAGAGCCAAGGAAAGGAAAGAGTTGAGCGGTGAATG
GAAGTCATTACTTGCTCAGGAGGCGCTACTGAAGAGCAAGAAATATTCGTTTTCAGCCGAACTCGCAAATGCAACATTTC
ATACTTGGGAAGAAGAAACTAGACGAATGGTTTTGTGA