Details for Arabidopsis Locus AT3G07700

Position : Chr3 ( 5`- 2459491 .. 2463965 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07700

Protein [Map View]
MAALLASQSCCYGGETARVTKAIGFSSSLENHFTGEATQCYGSKSKRFRIEMRQSELPSKVGINGRSVKMVPASEVVKRK
DGVNGSAGKGVNGASLVSSRNINGAASTLVKAPKKTTESYLPPPVEGVRVLPSDEGFSWADENYSSLQRSIDVWSFVISL
RIRILFDNSKWAYVGGFTEEKQKSRRRETASWLRESVLQLGPTFIKLGQLSSTRSDLFPREFVDELSKLQDRVPAFSPEK
AKRFIEAELGAPISVMYKEFEEQPIAAASLGQVHRAVLHNGEKVVVKVQRPGLKKLFDIDLRNLKLIAEYFQKSESFGTN
DWVGIYEECALILYQEIDYINEAKNADRFRRDFRNINWVRVPLVYWDYSAMKVLTLEYVPGVKINNLDALAARGFNRSRI
ASRAIEAYLIQILKTGFFHADPHPGNLAIDVDESIIYYDFGMMGEIKTFTRKRLLDLFYSVYEKDAKKVMQNLIDLEALQ
PTGDLSSVRRSVQFFLDNLLSQSPDQQQTLAAIGEVPIKTVPEKEAELYLYVVLTLKNSSFLWQDLFAISQDQPFRFPST
FTFVIRAFSTLEGIGYILDPEFSFVKVAAPYAQELLDLKQRQRSGTQLVQEIRKQADDARSSTLSMPYRVQRIEEFVKEL
DSGDLKLRVRVLESERAARKATILQMATMYTVLGGTLLNIGVTFSNQGSQLVANGSFIGAGIFMLLVLRSMQRVNKLDKF
EKMI*

DNA
ATGGCGGCTTTATTAGCTTCTCAGAGCTGCTGCTATGGCGGTGAGACCGCAAGAGTCACCAAAGCTATTGGTTTCAGTAG
CTCTTTGGAGAATCATTTCACTGGGGAAGCCACTCAGTGTTATGGCAGCAAGTCTAAGAGATTTCGTATTGAGATGAGAC
AGTCGGAATTGCCCTCTAAGGTTGGAATCAATGGACGTTCAGTCAAAATGGTTCCTGCGAGTGAGGTGGTGAAGAGGAAA
GATGGTGTGAATGGATCGGCTGGGAAAGGTGTTAATGGAGCGAGTTTGGTTAGTAGTAGAAACATTAATGGTGCGGCGTC
AACTTTGGTTAAGGCACCAAAGAAAACAACAGAATCGTACCTTCCTCCACCGGTTGAAGGAGTTAGGGTTCTTCCTTCTG
ATGAAGGTTTTAGCTGGGCTGATGAGAATTATAGCTCACTTCAACGCAGTATTGATGTTTGGTCATTTGTTATTTCCCTG
AGGATTCGTATCTTGTTCGATAATTCGAAATGGGCTTATGTTGGAGGATTCACAGAAGAAAAACAGAAAAGCAGAAGAAG
AGAAACAGCTTCATGGTTGAGAGAGAGTGTATTGCAGCTTGGTCCAACGTTTATCAAACTGGGACAGTTGTCTTCAACTA
GGTCAGACTTGTTTCCGCGCGAATTCGTGGATGAGCTTTCCAAGTTGCAGGACAGAGTCCCCGCTTTTTCTCCAGAGAAA
GCAAAGCGCTTCATTGAGGCTGAACTTGGGGCTCCTATTAGTGTAATGTATAAAGAATTTGAAGAGCAACCCATAGCTGC
AGCTAGCCTTGGTCAGGTACACAGAGCTGTTTTGCACAATGGCGAGAAAGTGGTAGTAAAAGTACAAAGACCCGGACTAA
AGAAACTTTTCGATATTGATCTACGAAATCTGAAGCTGATTGCCGAGTATTTCCAGAAAAGTGAATCATTTGGTACAAAC
GATTGGGTTGGTATCTATGAAGAATGTGCCTTAATTTTGTATCAAGAGATTGACTACATAAACGAAGCTAAGAACGCTGA
CAGATTCCGGAGAGACTTCCGGAATATAAACTGGGTCCGCGTACCTTTGGTTTATTGGGATTACTCTGCCATGAAGGTCT
TGACTTTGGAGTATGTACCAGGTGTTAAGATCAACAACTTGGACGCCTTAGCTGCACGGGGTTTTAACCGTTCTAGAATC
GCATCACGGGCCATTGAAGCTTATCTTATACAGATACTCAAAACCGGCTTCTTTCATGCGGATCCGCACCCAGGAAACCT
TGCAATTGATGTAGATGAATCAATCATCTACTATGACTTCGGCATGATGGGAGAGATCAAAACATTTACTCGGAAGAGAT
TACTTGATCTCTTCTATTCTGTTTATGAAAAAGATGCAAAAAAGGTCATGCAAAACCTTATAGACCTTGAAGCACTTCAA
CCCACTGGAGATCTTTCATCGGTAAGGAGATCTGTTCAGTTTTTCTTGGACAACCTATTAAGCCAATCACCAGATCAGCA
ACAGACTTTGGCAGCTATTGGAGAGGTACCGATCAAAACTGTACCTGAAAAAGAAGCTGAGCTCTATCTCTATGTGGTTC
TTACATTAAAAAATTCCTCCTTTCTATGGCAGGATCTGTTTGCAATTTCCCAGGATCAGCCATTCCGTTTCCCATCAACT
TTCACCTTTGTCATCCGAGCATTTTCCACACTTGAGGGTATTGGTTACATCCTTGATCCAGAATTTTCCTTTGTGAAGGT
TGCGGCTCCTTATGCGCAGGAACTCCTGGATCTAAAACAAAGGCAACGCTCGGGAACTCAGCTTGTCCAAGAAATAAGAA
AGCAGGCTGATGATGCCAGGTCTTCTACTCTGTCTATGCCATATCGAGTGCAGCGAATAGAAGAGTTTGTGAAAGAACTC
GATTCAGGCGATCTGAAACTCCGTGTTCGGGTTCTTGAGTCGGAAAGAGCAGCCCGGAAAGCGACAATACTGCAGATGGC
GACGATGTATACAGTTCTTGGAGGAACTCTACTTAATATTGGGGTTACATTTAGCAACCAAGGAAGTCAGCTTGTTGCCA
ATGGATCCTTCATTGGAGCAGGGATATTCATGTTATTGGTACTGAGGTCTATGCAAAGGGTAAATAAGCTTGATAAATTT
GAGAAGATGATATGA