Details for Arabidopsis Locus AT3G07670

Position : Chr3 ( 5`- 2451608 .. 2454860 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07670

Protein [Map View]
MAKACLLQSTLLPAYSPLHKLRNQNITLSFSPLPLSRCRPGIHCSVSAGETTIQSMEEAPKISWGCEIDSLENATSLQNW
LSDSGLPPQKMAIDRVDIGERGLVASQNLRKGEKLLFVPPSLVISADSEWTNAEAGEVMKRYDVPDWPLLATYLISEASL
QKSSRWFNYISALPRQPYSLLYWTRTELDMYLEASQIRERAIERITNVVGTYEDLRSRIFSKHPQLFPKEVFNDETFKWS
FGILFSRLVRLPSMDGRFALVPWADMLNHNCEVETFLDYDKSSKGVVFTTDRPYQPGEQVFISYGNKSNGELLLSYGFVP
REGTNPSDSVELALSLRKNDKCYEEKLDALKKHGLSTPQCFPVRITGWPMELMAYAYLVVSPPDMRNNFEEMAKAASNKT
STKNDLKYPEIEEDALQFILDSCETSISKYSRFLKESGSMDLDITSPKQLNRKAFLKQLAVDLSTSERRILYRAQYILRR
RLRDIRSGELKALRLFSGLRNFFK*

DNA
ATGGCAAAAGCTTGCCTCTTGCAGTCTACTCTACTCCCAGCTTACTCTCCACTTCACAAACTTCGTAATCAAAACATCAC
CCTCTCTTTCTCACCGCTTCCGCTGTCCCGATGCCGTCCCGGAATCCACTGCTCAGTTTCGGCCGGTGAGACTACAATAC
AATCCATGGAGGAAGCTCCGAAGATATCATGGGGATGCGAGATTGATTCACTTGAGAACGCTACTTCTCTTCAGAACTGG
CTCTCTGATTCAGGTCTCCCTCCGCAGAAAATGGCTATTGATAGAGTCGACATCGGTGAGCGAGGCCTCGTCGCTTCACA
GAATCTCAGAAAAGGAGAGAAATTGCTCTTCGTTCCTCCTTCTCTCGTCATCAGTGCTGATTCCGAATGGACCAACGCAG
AAGCTGGTGAAGTGATGAAACGTTATGATGTTCCAGATTGGCCTTTGCTCGCCACTTATCTTATAAGTGAAGCAAGTCTT
CAGAAAAGCTCAAGATGGTTTAACTATATCTCAGCTCTTCCCCGACAACCTTACTCGCTTTTATACTGGACTCGGACAGA
GCTTGATATGTACTTGGAAGCTTCTCAGATTCGAGAACGGGCAATTGAAAGAATCACCAATGTTGTTGGAACTTATGAAG
ATCTAAGAAGCAGGATATTTTCCAAACACCCTCAACTTTTCCCTAAAGAGGTTTTCAATGATGAGACATTTAAGTGGTCT
TTTGGAATCCTATTCTCACGGTTGGTGCGGTTGCCTTCTATGGATGGAAGATTTGCCTTAGTTCCATGGGCAGATATGCT
TAATCATAATTGTGAGGTTGAGACGTTCCTGGATTATGATAAATCTTCAAAAGGAGTTGTCTTTACAACAGATCGACCAT
ATCAACCAGGTGAGCAGGTTTTCATATCCTATGGGAATAAATCTAACGGAGAGCTATTGTTATCTTATGGGTTTGTTCCC
AGAGAAGGAACCAATCCTAGTGATTCAGTAGAACTAGCATTATCACTTAGGAAAAACGATAAGTGTTACGAGGAAAAGCT
GGATGCTTTAAAGAAACACGGATTATCGACACCTCAATGCTTTCCCGTAAGGATAACGGGTTGGCCAATGGAGCTAATGG
CATATGCTTATCTTGTGGTGAGCCCTCCAGATATGAGAAACAACTTTGAAGAGATGGCGAAAGCTGCTTCAAATAAGACA
TCAACAAAGAATGATCTAAAATATCCTGAAATCGAGGAAGACGCATTGCAGTTCATACTGGACTCATGCGAAACAAGCAT
ATCAAAGTACAGCCGATTTCTAAAGGAAAGTGGATCAATGGATTTGGACATAACATCTCCAAAACAGTTGAACCGAAAAG
CGTTTCTGAAACAGCTAGCTGTAGACTTGTCCACTAGTGAGCGCAGGATACTGTACCGTGCTCAATACATTCTGAGGAGG
AGACTGAGAGATATCAGAAGTGGTGAGCTGAAGGCTCTACGGCTCTTCAGTGGACTTAGGAACTTCTTCAAGTGA