Details for Arabidopsis Locus AT3G07660

Position : Chr3 ( 5`- 2444778 .. 2450561 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07660

Protein [Map View]
MVGSGARVSISATTRKMIQNIKETTAGNYSEDEIIAMLHECNMDPDETAQRLLLQDPFHEVKKKRDKRKENINNKDSAES
QWRSGGGGRGSRGGRMNFSSRHASNDVAGAKNSFKKENGPKQVIDPSTSTSQEIKTKDIALVSSHSAVMDKSTVGPKSGS
SDVRQSSNLPAGSGQLKAGRSSVPSNNIDGAPSSVELSKNRVAVGSRVVHTEQKAVDSLPLPRPSSSEVRFTSSNPKSEQ
TAPEQHIGESKSHTRSRGVGKTAVNDTYGSRPASSHSNSTGSRPSSNYSNRSHQTVGPQRGAGSIKEWKPKPVVNHNTTQ
GSGASSTGETLAVPTEASDKSVEDATPSAEATSRLQRQLEDLQIQRQHVIIPNHILVPEAERTKLSFGSFDADFSITSST
VAFPQSEKRSAPLSHNSQEVEESFAEEEFRHPTVHSIEKEEDGNVYSESPSQVPDNMAGEGNTATNTAPEYDVTKQENML
ESESNQNSFDQVPSNIIGIVPPAPGNQHPQFETSDPQARDALRLPSFMGQQPFDTASYYAQFYRSGPDSDGRVSPFVSPG
VASKFNGITVLPPHSSQTMQEGGNNLVLSTASPPPLVTQAAGLMQSSIPVTQQPVPVFRPPGLHMSHYPPNYVPYGYFSP
FYLPPPTMHQYLSNGAYAQQPQASGVYPPPPGTATGGKYTLPHYKPGTNTGNMTHVGITGGYGPTYGSFPAGYNPTSAAS
AGNSTSNEDLNSLQLKENNGYSTTGQQSEALPVWITGPGRDVPSSFYGLQHHGQHVTYAPAQAGHVAFPGMYHPGQAVTA
TGVHHPLLQQSQGVAGAEMVAPAPNVFQQPQQTQMNWPSNY*

DNA
ATGGTCGGCAGTGGCGCTAGGGTTTCGATTTCGGCTACTACTCGGAAGATGATTCAGAACATTAAGGAGACCACTGCTGG
GAACTATAGCGAGGATGAGATTATCGCAATGCTTCATGAATGTAACATGGATCCTGATGAGACCGCTCAACGCTTACTTC
TTCAGGATCCATTCCATGAGGTTAAAAAAAAGCGTGATAAGAGGAAAGAGAACATCAACAACAAGGATTCTGCTGAATCA
CAATGGAGATCTGGTGGAGGGGGCCGTGGTAGCAGGGGTGGTCGGATGAATTTCTCTTCTCGTCATGCATCAAATGATGT
TGCTGGTGCAAAGAATTCTTTCAAAAAAGAAAACGGTCCAAAGCAGGTTATTGATCCATCAACTTCAACCTCTCAAGAGA
TAAAAACGAAAGATATAGCTCTGGTCTCAAGCCATTCTGCTGTGATGGATAAAAGTACTGTTGGTCCGAAATCAGGAAGC
TCTGATGTTCGCCAGTCTTCCAACCTACCAGCTGGTTCAGGTCAACTTAAAGCTGGCCGATCTTCAGTGCCCTCAAACAA
CATTGATGGTGCACCGTCTTCTGTGGAATTAAGCAAAAATCGTGTAGCAGTTGGCTCTAGGGTTGTGCATACTGAGCAGA
AGGCAGTTGATTCTCTGCCACTCCCTCGTCCATCCTCTTCTGAAGTTCGATTCACATCTTCAAATCCCAAATCAGAGCAA
ACAGCACCTGAACAGCACATTGGAGAAAGCAAGTCCCATACCAGATCCCGTGGGGTTGGGAAGACTGCCGTGAATGATAC
TTATGGTTCAAGGCCTGCTTCATCTCATAGCAACAGCACGGGTAGTCGGCCTTCTTCTAACTACAGTAATCGGTCACATC
AGACTGTCGGTCCTCAAAGAGGTGCTGGTTCCATTAAGGAATGGAAACCGAAGCCAGTAGTGAACCATAACACTACCCAG
GGCTCTGGTGCATCATCTACAGGTGAAACTCTTGCAGTTCCTACTGAAGCCAGTGACAAATCAGTTGAAGATGCTACCCC
TTCGGCAGAAGCCACATCCAGATTGCAGAGACAGCTTGAAGACTTGCAGATTCAACGTCAGCATGTTATTATTCCAAACC
ATATTCTTGTTCCAGAGGCTGAACGAACCAAGTTAAGCTTTGGAAGCTTTGATGCTGACTTTTCTATTACGTCTAGCACA
GTAGCCTTTCCTCAGAGTGAAAAGAGATCTGCACCTCTTTCTCATAATTCGCAGGAAGTTGAAGAAAGTTTTGCAGAGGA
GGAATTTAGGCACCCAACTGTCCATTCGATTGAAAAAGAAGAGGACGGTAATGTTTACTCCGAGTCACCTTCACAAGTTC
CAGATAATATGGCTGGTGAAGGTAATACTGCAACAAATACAGCTCCAGAGTATGATGTCACCAAGCAGGAGAATATGTTG
GAGTCCGAAAGCAATCAAAACTCGTTTGACCAGGTTCCAAGTAATATTATTGGGATTGTTCCTCCAGCTCCTGGGAACCA
GCATCCACAATTTGAGACTTCTGACCCTCAAGCACGTGATGCCCTTCGTCTTCCCAGTTTTATGGGCCAACAACCTTTTG
ATACGGCGAGCTACTATGCTCAGTTCTACCGCTCAGGTCCTGACAGTGATGGCCGTGTTTCTCCCTTCGTTTCCCCAGGG
GTTGCCTCCAAATTTAATGGGATTACAGTATTGCCTCCGCATTCATCTCAAACCATGCAAGAGGGTGGAAATAACTTGGT
CCTGTCTACTGCTAGTCCACCACCACTGGTAACTCAAGCTGCTGGACTAATGCAGAGCTCTATACCTGTCACGCAGCAGC
CTGTTCCTGTTTTCCGCCCTCCGGGCTTACATATGTCGCATTATCCACCAAACTACGTGCCATATGGATACTTCTCCCCA
TTCTATTTACCTCCCCCTACAATGCACCAATACTTAAGCAATGGTGCATATGCTCAGCAACCTCAGGCAAGCGGTGTATA
TCCTCCACCTCCTGGAACTGCAACAGGAGGCAAATACACACTCCCTCATTACAAGCCTGGGACTAATACAGGAAACATGA
CTCATGTCGGTATTACTGGTGGGTATGGACCAACATATGGGTCTTTCCCAGCAGGATATAATCCCACCTCTGCTGCATCG
GCCGGGAATTCGACTTCCAATGAGGATCTCAACTCATTGCAGTTGAAAGAAAACAACGGCTACAGTACAACAGGGCAACA
GAGTGAAGCATTACCTGTATGGATTACTGGACCAGGACGAGATGTGCCAAGCTCTTTCTATGGTTTACAGCACCATGGGC
AACACGTGACTTATGCTCCAGCACAAGCTGGTCACGTCGCATTCCCAGGTATGTACCATCCGGGACAAGCAGTAACAGCA
ACAGGAGTCCATCATCCGCTTTTACAACAGTCTCAAGGTGTGGCTGGAGCTGAAATGGTTGCACCTGCGCCTAACGTTTT
CCAACAGCCTCAGCAAACACAGATGAATTGGCCAAGTAATTACTGA