Details for Arabidopsis Locus AT3G07650

Position : Chr3 ( 5`- 2441657 .. 2444532 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07650

Protein [Map View]
MGYMCDFCGEQRSMVYCRSDAACLCLSCDRSVHSANALSKRHSRTLVCERCNAQPATVRCVEERVSLCQNCDWSGHNNSN
NNNSSSSSTSPQQHKRQTISCYSGCPSSSELASIWSFCLDLAGQSICEQELGMMNIDDDGPTDKKTCNEDKKDVLVGSSS
IPETSSVPQGKSSSAKDVGMCEDDFYGNLGMDEVDMALENYEELFGTAFNPSEELFGHGGIDSLFHKHQTAPEGGNSVQP
AGSNDSFMSSKTEPIICFASKPAHSNISFSGVTGESSAGDFQECGASSSIQLSGEPPWYPPTLQDNNACSHSVTRNNAVM
RYKEKKKARKFDKRVRYASRKARADVRRRVKGRFVKAGEAYDYDPLTPTRSY*

DNA
ATGGGTTACATGTGTGACTTCTGTGGTGAACAAAGATCTATGGTGTACTGTCGATCCGATGCAGCTTGTTTGTGTCTCTC
CTGTGACCGGAGTGTTCATTCCGCTAATGCATTGTCCAAACGACATTCTCGGACACTTGTCTGCGAGAGATGCAATGCTC
AGCCTGCTACTGTCAGGTGTGTTGAAGAAAGGGTTTCACTCTGTCAAAACTGTGACTGGTCTGGCCACAACAACAGCAAC
AACAACAATTCTTCGTCTTCTTCTACTTCGCCGCAGCAGCATAAGAGGCAAACCATAAGTTGCTATTCGGGTTGCCCTTC
CAGCTCAGAACTCGCTTCCATTTGGTCTTTCTGTTTGGACTTAGCTGGACAATCTATTTGTGAACAAGAACTGGGTATGA
TGAATATAGACGATGATGGTCCTACCGACAAGAAAACTTGTAATGAGGATAAGAAAGATGTCTTGGTTGGATCCTCTTCA
ATTCCTGAAACCAGTTCTGTACCACAAGGAAAATCATCTTCTGCTAAGGATGTTGGAATGTGTGAAGATGACTTCTACGG
GAACCTTGGTATGGATGAAGTTGACATGGCACTTGAGAACTATGAAGAACTCTTTGGTACCGCCTTTAACCCCTCTGAAG
AGCTATTCGGGCATGGTGGAATCGATAGCCTTTTCCATAAGCACCAAACAGCTCCAGAGGGAGGGAATTCGGTGCAGCCA
GCAGGCAGTAATGATTCGTTCATGAGTTCGAAAACTGAGCCAATAATTTGCTTCGCATCGAAGCCAGCACATTCGAACAT
ATCCTTCTCTGGAGTCACTGGAGAAAGTAGTGCTGGAGATTTCCAAGAATGTGGTGCATCATCTTCCATACAGCTCTCGG
GGGAGCCACCATGGTATCCTCCAACATTACAGGATAACAATGCCTGCTCACATTCAGTAACCCGTAATAACGCAGTTATG
CGTTACAAGGAGAAGAAGAAGGCTCGCAAGTTTGATAAGAGAGTGAGGTATGCTTCCCGCAAAGCAAGAGCTGATGTGAG
ACGGCGTGTAAAGGGGCGATTTGTCAAAGCTGGTGAAGCTTATGATTACGACCCTCTCACCCCAACCAGAAGTTATTGA