Details for Arabidopsis Locus AT3G07640

Position : Chr3 ( 5`- 2438132 .. 2439883 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07640

Protein [Map View]
MKVAEKIVFLWNDSDGFAATISDTLNPSPSSPLRKLEEQIQLPLDKYGVEGVETGGSIVHFVDENEVYQVSIFLLRSYEP
PVLVCAMNELLDLITRGSSTLPTIIAPFFVAASKLKFNNRSLEANNRKASLHYVQVATETETSRLFASRIEKPPLSMQIH
YEPLSCLLHLARVKRLPTAILIGQRSNSLTHKALDEELQVIHETGELVASWTGLSFSRDRIKWSASKTSKEEESPWRALY
G*

DNA
ATGAAAGTAGCGGAGAAGATTGTTTTCCTCTGGAATGATTCCGATGGATTTGCTGCAACCATTTCTGATACTTTAAACCC
TAGCCCTAGTTCCCCTCTTCGCAAACTAGAAGAACAGATCCAGCTTCCGTTGGATAAGTATGGCGTTGAAGGTGTGGAAA
CCGGCGGGAGTATCGTTCATTTCGTAGATGAAAATGAAGTTTATCAGGTCTCGATTTTTCTTCTTCGAAGTTATGAGCCT
CCAGTACTAGTGTGTGCTATGAATGAACTGCTGGACCTAATTACAAGGGGATCGTCAACTCTACCCACAATCATAGCTCC
TTTCTTTGTGGCGGCATCTAAGCTCAAGTTCAATAACAGATCCCTGGAAGCAAATAACAGAAAAGCTAGTCTTCATTACG
TTCAAGTTGCTACAGAAACAGAGACCAGTAGGTTATTTGCTTCTCGCATCGAGAAACCACCACTATCGATGCAGATCCAT
TATGAACCTTTGTCATGCTTGCTTCATCTAGCTCGTGTTAAACGCCTGCCTACCGCTATTCTCATAGGCCAAAGAAGCAA
TAGCCTAACTCATAAAGCTCTAGACGAAGAGCTTCAGGTGATCCATGAAACAGGGGAGCTCGTGGCTAGTTGGACAGGAC
TGTCTTTCTCAAGAGACAGAATCAAGTGGAGCGCATCAAAGACATCAAAAGAAGAAGAAAGTCCGTGGCGTGCTCTTTAT
GGCTAA