Details for Arabidopsis Locus AT3G07610

Position : Chr3 ( 5`- 2426069 .. 2432913 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07610

Protein [Map View]
MDSVEEEGVVRVEEENGRGGLRRHRRVSTKLANYVDPPTDDEEDGGPKRKGKRGGNRAPKKTPKKDEEMQKNEIDEANRV
TGLVKEKRAATKILNRKDSIIEVGEASGSMPKEVKGIRIGKRKGEIDGEIPTKPGKKPKTTVDPRIIGYRPDNMCHQCQK
SDRIVERCQTCNSKRYCHPCLDTWYPLIAKEDVAKKCMFCSSTCNCRACLRLDTKLKGINSNLIVSEEEKVQASKFILQS
LLPHLKGINDEQVAEKEVEAKIYGLKFEEVRPQDAKAFPDERLYCDICKTSIYDLHRNCKSCSFDICLSCCLEIRNGKAL
ACKEDVSWNYINRGLEYEHGQEGKVIEKPANKLDDKLKDKLDGKPDDKPKGKPKGRPKGKPDDKPKGKLKGKQDDKPDDK
PDEKPVNTDHMKYPSLWKANEAGIITCCCGAGELVLKRLLPDGWISELVNRVEKTAEAGELLNLPETVLERCPCSNSDRH
IDIDSCNLLKAACREGSEDNYLYSPSVWDVQQDDLKHFQHHWVKGEPVIVRNVLEATSGLSWEPMVMHRACRQISHVQHG
SLKDVVAVDCLDFCEVKVNLHEFFTGYTDGRYDRMGWPLVLKLKDWPPAKVFKDNLPRHAEEFLCSLPLKHYTHPVNGPL
NLAVKLPQNCLKPDMGPKTYVASGFAQELGRGDSVTKLHCDMSDADLWTKLYPFNVSPSIAFLVLHRPGIRFLVLLMPNM
QPGIGNLKKKHAEQDLKELYSSVANKEEMMEILENSRQQVQNVETDDGALWDIFRREDIPKLESYIEKHHKEFRHLYCCP
VSQVVHPIHDQNFYLTRYHIMKLKEEYGIEPWTFNQKLGDAVLIPVGCPHQVRNLKSCNKVALDFVSPENVSECLRLTKQ
YRLLPPNHFAKEDKLGVKKMIVHAVDKALRDLSGEKSPEPEEKKQNMRGPKKGAAKAVAKALKDLSPSEKKSSEAAEEEI
SNGIVNAIDKGLKDLPPSEEKSSEAKVEISNGIVSAMDKDLEHISSSEKKSTEEEGVKRPNIVRTYERRKKLGSEVTNAY
IDRLEMEKM*

DNA
ATGGATTCTGTGGAGGAAGAAGGTGTTGTTAGGGTTGAAGAAGAGAACGGACGCGGTGGTCTCCGTAGGCATCGGAGGGT
TTCTACGAAGCTGGCGAATTACGTAGATCCTCCGACTGACGACGAAGAAGATGGAGGACCCAAGCGAAAGGGCAAAAGGG
GTGGAAATAGGGCTCCGAAAAAGACACCGAAGAAAGACGAGGAGATGCAAAAGAACGAAATTGATGAAGCAAACCGAGTC
ACTGGTCTGGTGAAGGAAAAAAGAGCCGCGACTAAGATTCTGAATCGCAAAGACTCCATTATTGAAGTAGGAGAAGCTTC
TGGAAGCATGCCCAAGGAAGTAAAGGGAATTAGGATTGGGAAAAGGAAGGGAGAAATCGATGGTGAGATTCCAACTAAGC
CGGGCAAGAAGCCAAAGACTACAGTAGACCCGAGAATCATTGGTTACAGACCGGACAATATGTGCCATCAATGTCAAAAG
AGCGATAGGATTGTTGAACGGTGTCAGACCTGCAATAGTAAGCGTTATTGTCATCCATGCTTGGACACTTGGTACCCCCT
TATAGCAAAAGAAGATGTTGCCAAGAAATGCATGTTCTGCTCTAGTACTTGCAATTGCAGAGCATGCTTGCGTCTAGATA
CTAAATTGAAAGGGATAAATTCGAACCTCATAGTCAGCGAGGAAGAAAAGGTCCAAGCCTCTAAGTTTATTCTGCAGAGC
CTTCTCCCACATCTGAAAGGAATAAATGATGAACAAGTTGCTGAGAAGGAAGTTGAGGCCAAAATATACGGACTGAAGTT
TGAAGAGGTGAGGCCCCAAGACGCTAAAGCTTTCCCTGATGAAAGACTATACTGTGATATCTGCAAGACTTCTATCTATG
ATCTCCATAGGAATTGCAAGTCCTGTAGTTTTGATATCTGCCTTAGCTGTTGCCTTGAGATCCGCAATGGAAAGGCTCTG
GCATGTAAGGAGGATGTGTCTTGGAATTATATTAACCGAGGTTTAGAGTATGAACATGGACAAGAAGGAAAAGTGATTGA
AAAGCCGGCGAATAAGCTAGATGATAAGTTGAAAGATAAGCTGGATGGTAAGCCGGATGATAAGCCGAAGGGTAAGCCAA
AGGGTAGGCCAAAGGGTAAGCCGGATGATAAGCCGAAGGGTAAACTGAAGGGTAAGCAGGATGATAAACCGGATGATAAG
CCAGATGAGAAGCCGGTTAATACAGACCATATGAAGTACCCTTCTCTGTGGAAAGCAAATGAAGCTGGGATCATTACTTG
TTGTTGTGGTGCTGGGGAGTTAGTGCTGAAACGACTACTTCCGGATGGTTGGATATCTGAGTTGGTCAACAGAGTTGAAA
AAACTGCTGAAGCTGGCGAGCTTTTGAATTTACCTGAAACGGTTTTGGAGCGATGCCCTTGTTCTAACTCTGACAGACAT
ATTGACATAGACAGCTGTAATTTGTTAAAAGCTGCTTGTCGAGAAGGTTCAGAAGACAATTATCTTTACTCTCCAAGTGT
ATGGGATGTTCAACAAGATGATTTGAAGCATTTTCAGCACCATTGGGTAAAAGGCGAGCCTGTGATTGTGAGAAATGTGC
TTGAAGCTACATCTGGTTTAAGCTGGGAACCAATGGTAATGCATCGTGCCTGCCGCCAGATAAGCCATGTCCAGCATGGA
TCACTTAAGGATGTTGTTGCTGTTGATTGTTTGGACTTCTGTGAGGTAAAAGTTAATCTTCATGAATTTTTTACTGGATA
CACGGATGGCCGATATGATCGAATGGGTTGGCCACTAGTTCTGAAACTGAAAGATTGGCCTCCAGCTAAAGTCTTCAAAG
ATAACTTGCCACGTCATGCTGAGGAGTTCTTATGTAGTTTGCCTTTGAAGCATTACACTCATCCGGTTAATGGACCTTTG
AATCTCGCTGTCAAGCTTCCCCAAAATTGCTTGAAGCCAGACATGGGACCAAAGACGTACGTTGCTTCTGGATTTGCTCA
AGAATTAGGCCGTGGAGATTCTGTTACTAAGCTCCACTGCGACATGTCTGATGCGGACCTATGGACCAAGCTTTATCCAT
TCAATGTGAGTCCATCAATAGCTTTCTTAGTCCTTCATAGGCCTGGCATTCGGTTTTTGGTTCTGTTAATGCCCAATATG
CAACCTGGAATTGGAAATCTGAAAAAGAAGCATGCCGAACAAGATCTCAAGGAGCTGTATAGCTCAGTAGCTAACAAGGA
GGAAATGATGGAGATTCTTGAAAATTCCAGACAACAAGTCCAAAATGTTGAAACTGATGATGGAGCTCTTTGGGACATTT
TCCGTAGAGAAGATATTCCTAAATTAGAAAGTTACATTGAGAAACATCACAAGGAGTTCAGACATCTCTACTGCTGTCCT
GTGTCTCAGGTTGTTCATCCTATACATGACCAGAACTTCTATCTGACGCGGTATCATATAATGAAGCTGAAAGAAGAATA
TGGCATTGAACCTTGGACCTTCAATCAGAAGCTTGGTGATGCTGTTTTGATACCTGTAGGTTGCCCTCATCAAGTTAGAA
ATTTGAAGTCCTGCAATAAGGTAGCGCTTGACTTCGTCTCACCTGAAAATGTCAGCGAGTGTTTACGCTTGACAAAACAG
TATCGTCTACTTCCACCAAATCATTTTGCAAAAGAAGACAAGTTAGGGGTTAAGAAGATGATAGTCCATGCAGTTGATAA
AGCTCTCAGAGACTTAAGTGGAGAGAAGTCTCCAGAACCTGAAGAGAAGAAACAAAATATGAGAGGGCCGAAGAAGGGGG
CAGCCAAGGCAGTTGCCAAGGCTCTCAAAGACTTATCTCCAAGTGAAAAGAAGTCTTCGGAAGCAGCTGAAGAGGAGATA
TCAAATGGGATAGTCAATGCAATCGATAAGGGTCTCAAAGACTTACCTCCAAGTGAAGAGAAGTCTTCCGAAGCCAAAGT
GGAGATATCAAATGGGATAGTCAGTGCAATGGATAAGGATCTCGAACACATATCTTCAAGCGAAAAGAAGTCTACGGAAG
AGGAAGGGGTGAAAAGACCAAATATTGTGAGGACATATGAGCGGAGAAAAAAGCTGGGAAGTGAAGTAACCAACGCATAC
ATTGACAGATTAGAAATGGAGAAGATGTAG