Details for Arabidopsis Locus AT3G07590

Position : Chr3 ( 5`- 2423070 .. 2424594 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07590

Protein [Map View]
MKLVRFLMKLNNETVSIELKNGTVVHGTITGVDVSMNTHLKTVKMSLKGKNPVTLDHLSLRGNNIRYYILPDSLNLETLL
VEDTPRVKPKKPVAGKAVGRGRGRGRGRGRGRGR*

DNA
ATGAAGCTCGTCAGGTTTTTGATGAAGTTAAACAATGAAACTGTGTCTATCGAGCTGAAGAATGGGACTGTGGTCCATGG
AACCATCACTGGTGTTGATGTGAGCATGAACACTCACTTGAAGACAGTGAAGATGAGCCTGAAGGGGAAAAACCCAGTAA
CACTTGATCATCTTAGCTTGAGGGGTAATAATATTCGCTACTACATTCTTCCTGATAGCTTGAACCTCGAGACTTTACTT
GTGGAAGACACTCCTAGAGTTAAACCTAAGAAGCCTGTTGCTGGGAAAGCTGTTGGACGCGGTCGCGGACGTGGCCGTGG
GCGTGGTCGCGGCAGAGGTCGTTAG