Details for Arabidopsis Locus AT3G07568

Position : Chr3 ( 5`- 2416243 .. 2417790 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07568

Protein [Map View]
MLRTRLLWFTLGFSVTGGSIAHIVWRDLYAERFAISSDMKEKFSALEGRVSGLESGGYENPNPAQVES*

DNA
ATGTTGAGAACTCGCCTTCTCTGGTTTACGCTTGGTTTTTCCGTGACCGGAGGTTCCATTGCTCATATCGTGTGGCGTGA
TCTCTATGCCGAACGTTTCGCTATTTCTTCTGATATGAAGGAGAAATTCAGTGCTCTGGAAGGTAGAGTATCAGGTTTGG
AGTCTGGTGGTTATGAGAACCCGAATCCAGCTCAGGTTGAGAGTTGA