Details for Arabidopsis Locus AT3G07565

Position : Chr3 ( 5`- 2413640 .. 2416284 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07565

Protein [Map View]
MAASANPSGNNQEGSSATQKVSSSSAAAANGAAVNSVDNGGNTGAAADNSQTIGALRHNPGISTDWTLEEQSLLEDLLVK
YATEPSVFRYAKIAMKMKDKTVRDVALRCRWMTKKENGKRRKEDHSSRKSKDKKQEKATDSSAKSSSHLNVHPNGPSYAP
PMMPIDTDDGISYKAIGGVSGDLLEQNAQMFNQLSTNFSAFQVNSTSTFHLLHENVNILCKARDNILAILNDLNDMPEVM
KQMPPLPVKLNEELANSILPRPSHQRKS*

DNA
ATGGCGGCGAGCGCGAACCCGTCGGGGAACAATCAGGAAGGTTCGTCGGCGACGCAGAAGGTATCGTCTTCTTCAGCGGC
GGCGGCGAATGGCGCTGCTGTGAATTCCGTCGATAATGGTGGAAATACAGGCGCGGCGGCGGATAATTCACAGACGATTG
GCGCGTTGAGGCATAATCCAGGGATCTCTACCGATTGGACTCTTGAGGAACAATCTCTATTGGAAGATTTGCTTGTCAAG
TACGCGACAGAACCGTCGGTTTTTCGATATGCGAAGATTGCTATGAAAATGAAAGATAAGACTGTTCGAGATGTTGCCCT
GCGCTGTAGATGGATGACTAAAAAGGAAAACGGAAAGCGTAGGAAAGAAGATCATTCCTCGAGGAAAAGCAAAGATAAGA
AACAGGAAAAAGCTACAGATTCTTCAGCCAAGTCCTCATCTCATTTGAATGTTCATCCTAATGGTCCTTCTTATGCTCCG
CCTATGATGCCTATCGATACTGATGATGGTATTTCATATAAAGCTATTGGTGGTGTGAGTGGAGATCTTCTCGAGCAAAA
TGCTCAAATGTTCAATCAACTTTCAACAAATTTCTCAGCTTTCCAGGTGAATTCAACTTCCACTTTTCATCTTCTACATG
AGAATGTCAATATCTTGTGCAAAGCTCGAGACAATATCCTTGCAATCTTGAACGACTTGAATGACATGCCAGAAGTTATG
AAGCAGATGCCACCTCTTCCGGTGAAGTTGAATGAGGAGCTGGCAAATTCGATCCTCCCTCGCCCATCCCATCAAAGGAA
GTCATGA