Details for Arabidopsis Locus AT3G07560

Position : Chr3 ( 5`- 2411321 .. 2413475 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07560

Protein [Map View]
MASQPAGGSPPKPWEKEGNTSGPNPFRPPSNTSTAGSVEASGTANPGEVVPPPVNRPNTAANMNSLSRPVPARPWEQQNY
GSTMGGGYGSNLGMTSGYGSGTYGSALGGYGSSYGGGMYGGSSMYRGGYGGGGLYGSSGMYGGGAMGGYGGTMGGYGMGM
GTGMGMGMGMGMGGPYGSQDPNDPFNQPPSPPGFWISFLRVMQGAVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRGGML
YGELARFVLRMLGVRTRPRKMQQPPQGPNGLPLPHQPHGNQNYLEGPKTAAPGGGGGWDNVWGN*

DNA
ATGGCGTCTCAGCCTGCAGGTGGCAGTCCTCCTAAACCTTGGGAAAAAGAAGGAAATACATCTGGTCCTAATCCTTTCAG
GCCTCCTTCTAATACTAGCACGGCTGGTTCAGTTGAGGCTTCTGGCACAGCTAATCCTGGTGAAGTAGTTCCTCCGCCCG
TGAACAGGCCTAATACAGCTGCTAATATGAATTCACTCAGTAGGCCTGTACCGGCTAGACCTTGGGAACAGCAGAATTAT
GGGAGCACTATGGGGGGAGGTTATGGTTCAAATCTAGGTATGACCTCTGGGTATGGGTCAGGTACATATGGTTCAGCATT
AGGTGGGTATGGTTCATCATATGGTGGTGGGATGTATGGAGGTAGTAGCATGTATAGAGGAGGTTATGGTGGTGGTGGGC
TCTATGGAAGTTCAGGCATGTATGGTGGTGGTGCGATGGGTGGTTATGGTGGCACGATGGGTGGTTATGGTATGGGTATG
GGAACGGGAATGGGAATGGGGATGGGAATGGGAATGGGTGGTCCTTATGGTAGTCAAGATCCAAATGACCCTTTTAATCA
ACCTCCATCTCCACCAGGCTTCTGGATATCATTTCTCCGTGTGATGCAAGGTGCTGTGAATTTCTTTGGCCGTGTAGCGA
TGCTTATAGATCAAAACACACAGGCCTTTCACATGTTCATGTCTGCCCTTCTTCAGCTATTTGATCGTGGTGGTATGTTA
TATGGAGAATTAGCAAGATTTGTACTGCGTATGCTTGGGGTGAGAACAAGGCCTAGAAAGATGCAGCAGCCACCACAAGG
GCCTAATGGGCTACCTTTACCACACCAGCCACATGGAAACCAGAACTACCTCGAGGGGCCTAAAACTGCTGCACCAGGTG
GTGGCGGTGGTTGGGACAATGTATGGGGCAACTAA