Details for Arabidopsis Locus AT3G07450

Position : Chr3 ( 5`- 2383610 .. 2383930 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07450

Protein [Map View]
MIVMKKSQVFTVMLLMVMVQSGLVRETLGHPCGRTFLSALIQLVPCRPSVAPFSTLPPNGLCCAAIKTLGQPCLCVLAKG
PPIVGVDRTLALHLPGKCSANFLPCN*

DNA
ATGATTGTAATGAAAAAGAGTCAGGTTTTTACAGTGATGTTACTTATGGTTATGGTCCAGTCAGGTCTGGTGAGAGAGAC
GCTGGGACACCCATGTGGTCGTACATTTTTGTCGGCTTTGATTCAGCTAGTGCCGTGTAGACCATCAGTGGCTCCGTTTA
GCACATTGCCTCCGAACGGGCTATGTTGCGCTGCCATCAAGACACTTGGTCAACCTTGTTTATGCGTTCTTGCCAAGGGA
CCACCCATCGTTGGCGTTGACCGGACCCTCGCTCTCCATTTACCTGGAAAATGTTCTGCCAATTTTCTTCCATGTAATTA
A