Details for Arabidopsis Locus AT3G07425

Position : Chr3 ( 5`- 2378350 .. 2378805 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07425

Protein [Map View]
MVRRNAVHAMSSLPSRSWWPQQRRKGKRVVVRLGNRRRGFLVGPPRMVMQRWRMNMGKPMKMMRSIILGILSNGGNVKFL
DAYLWSLPILRPHLFPLC*

DNA
ATGGTAAGAAGAAACGCAGTTCATGCCATGTCAAGTCTTCCGTCAAGGTCCTGGTGGCCGCAACAACGAAGGAAAGGAAA
ACGAGTCGTCGTGCGGTTAGGAAACCGGCGACGAGGGTTTTTGGTGGGGCCACCGCGGATGGTTATGCAGAGATGGAGGA
TGAACATGGGAAAGCCGATGAAGATGATGAGAAGTATCATTTTGGGGATACTCTCAAATGGTGGAAATGTTAAGTTCTTA
GATGCTTACCTTTGGTCTTTACCAATCTTACGTCCTCACTTGTTTCCACTGTGTTGA