Details for Arabidopsis Locus AT3G07300

Position : Chr3 ( 5`- 2324617 .. 2327625 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07300

Protein [Map View]
MPDVQSTVVEFVNKLRKRKIEGSQATAKYTVELLRSVISHQRVPHANQAAALIDAVKAVGEQLIAANPVELAVGNVVRRV
LHIIREEDLSLTTAAMGGLDLLDASDDDDVDNCKGIGFPAMSAAVVAAAARSTLRPPSLQTLLEGTPESATVPYTSSSGA
DSESKSKSADKSSLTRKLKHDVIEGVNQLIQEIAGCHEQIAEQAIEHIHQNEVILTLGSSRTVLEFLCAAKEKKRSFRVF
VAEGAPRYQGHLLAKELVARGLQTTVITDSAVFAMISRVNMVIIGAHAVMANGGVIGPVGVNMAALAAQKHAVPFVVLAG
SHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCLDFGAGSGSLQVVNPTFDYVPPNLVSLFITDTGGHNPSYMYRLIAD
YYSADDLVM*

DNA
ATGCCAGACGTTCAATCAACGGTGGTGGAATTTGTTAACAAGCTCAGAAAGCGTAAGATTGAGGGCTCACAGGCTACAGC
CAAATACACCGTAGAGCTACTTAGGTCAGTAATTTCGCATCAGCGGGTGCCTCACGCTAACCAAGCTGCCGCTCTTATCG
ATGCTGTGAAAGCTGTTGGTGAGCAATTGATCGCTGCTAATCCTGTTGAGCTTGCGGTGGGAAATGTAGTTAGACGGGTT
TTGCATATTATAAGGGAGGAAGATCTTTCTCTAACTACAGCAGCTATGGGTGGTTTGGACTTGTTGGATGCAAGTGATGA
TGATGATGTAGACAATTGCAAAGGAATTGGGTTTCCTGCAATGTCTGCAGCAGTTGTTGCAGCTGCAGCTAGGAGTACAT
TACGCCCTCCATCTTTGCAAACGCTTCTCGAGGGCACTCCTGAATCTGCAACTGTTCCATACACATCTTCATCTGGTGCT
GATTCCGAAAGCAAAAGTAAATCTGCCGATAAAAGTTCGTTAACTCGGAAGCTGAAGCATGATGTTATCGAAGGAGTGAA
TCAACTTATTCAAGAGATTGCTGGTTGTCATGAGCAGATCGCTGAACAAGCTATAGAGCATATACATCAAAATGAGGTGA
TCCTAACCCTGGGTAGCTCAAGAACAGTGCTTGAGTTTCTGTGTGCTGCAAAGGAGAAAAAAAGATCTTTTCGTGTATTT
GTTGCCGAAGGTGCTCCAAGATATCAGGGCCATCTATTAGCAAAAGAATTGGTAGCTAGAGGTTTGCAGACAACTGTGAT
CACCGACTCTGCAGTGTTTGCTATGATATCTCGAGTGAATATGGTTATAATTGGAGCTCATGCAGTGATGGCTAATGGTG
GAGTTATAGGGCCAGTTGGTGTCAACATGGCTGCTCTTGCAGCACAAAAGCACGCAGTCCCATTCGTGGTTCTTGCTGGT
AGTCACAAGTTGTGTCCCCTCTATCCTCACAATCCGGAAGTATTACTAAATGAGCTGAGATCTCCATCTGAACTGTTGGA
TTTTGGTGAATTCTCTGATTGCCTGGATTTTGGAGCAGGTTCCGGGTCTCTTCAAGTTGTCAACCCAACATTCGATTATG
TCCCACCAAACCTTGTTAGTCTCTTTATAACAGACACGGGAGGACACAATCCATCCTACATGTACCGTCTTATTGCGGAC
TACTACTCTGCTGATGATTTGGTGATGTAG