Details for Arabidopsis Locus AT3G07290

Position : Chr3 ( 5`- 2321740 .. 2324382 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07290

Protein [Map View]
MLLIHIRSTRKILALGRHVFPSNAFFSVSSRPSLSSSDEVAAHDVASLLKTPNWEKNSSLKSLVSHMNPNVASQVISLQR
SDNDICVRFFMWVCKHSSYCFDPTQKNQLLKLIVSSGLYRVAHAVIVALIKECSRCEKEMLKLMYCFDELREVFGFRLNY
PCYSSLLMSLAKLDLGFLAYVTYRRMEADGFVVGMIDYRTIVNALCKNGYTEAAEMFMSKILKIGFVLDSHIGTSLLLGF
CRGLNLRDALKVFDVMSKEVTCAPNSVSYSILIHGLCEVGRLEEAFGLKDQMGEKGCQPSTRTYTVLIKALCDRGLIDKA
FNLFDEMIPRGCKPNVHTYTVLIDGLCRDGKIEEANGVCRKMVKDRIFPSVITYNALINGYCKDGRVVPAFELLTVMEKR
ACKPNVRTFNELMEGLCRVGKPYKAVHLLKRMLDNGLSPDIVSYNVLIDGLCREGHMNTAYKLLSSMNCFDIEPDCLTFT
AIINAFCKQGKADVASAFLGLMLRKGISLDEVTGTTLIDGVCKVGKTRDALFILETLVKMRILTTPHSLNVILDMLSKGC
KVKEELAMLGKINKLGLVPSVVTYTTLVDGLIRSGDITGSFRILELMKLSGCLPNVYPYTIIINGLCQFGRVEEAEKLLS
AMQDSGVSPNHVTYTVMVKGYVNNGKLDRALETVRAMVERGYELNDRIYSSLLQGFVLSQKGIDNSEESTVSDIALRETD
PECINELISVVEQLGGCISGLCIFLVTRLCKEGRTDESNDLVQNVLERGVFLEKAMDIIMESYCSKKKHTKCMELITLVL
KSGFVPSFKSFCLVIQGLKKEGDAERARELVMELLTSNGVVEKSGVLTYVECLMEGDETGDCSEVIDLVDQLHCRERPTF
*

DNA
ATGCTGCTGATACATATCAGAAGTACTCGAAAGATCTTAGCTTTGGGGCGTCATGTTTTTCCTTCTAATGCCTTCTTCTC
CGTCTCTTCTCGACCTTCTCTGTCTTCCTCGGACGAAGTGGCGGCTCATGATGTCGCATCTTTGCTAAAAACCCCCAATT
GGGAGAAGAACAGTTCTCTTAAATCTCTAGTCTCTCACATGAATCCAAATGTCGCTTCACAGGTCATTTCGCTTCAACGC
AGTGACAACGATATTTGCGTTCGCTTTTTCATGTGGGTCTGCAAGCATTCGTCGTATTGTTTCGACCCAACTCAGAAAAA
TCAGCTTTTGAAACTGATTGTTTCTTCCGGATTGTATCGAGTTGCGCATGCTGTTATTGTTGCGTTGATCAAGGAATGTA
GTAGATGCGAGAAAGAGATGTTGAAACTAATGTATTGTTTTGATGAGCTGAGAGAAGTTTTTGGGTTCCGGTTAAATTAC
CCTTGTTACAGCTCTCTTTTGATGTCCTTAGCTAAACTTGATTTAGGATTTTTGGCTTACGTGACTTATAGAAGAATGGA
AGCTGACGGATTTGTTGTTGGTATGATTGATTACAGAACCATTGTCAATGCTCTGTGTAAGAATGGATACACGGAAGCCG
CTGAGATGTTCATGTCTAAGATTCTTAAAATTGGGTTTGTGTTAGATTCCCATATAGGCACTTCTTTGTTACTGGGTTTT
TGCCGTGGATTGAATCTCAGAGATGCACTCAAGGTGTTTGATGTAATGTCTAAGGAGGTAACTTGTGCACCGAACTCTGT
TAGTTACTCCATTTTGATTCACGGGTTGTGTGAAGTAGGGAGACTTGAAGAAGCATTTGGCCTAAAAGATCAAATGGGTG
AGAAAGGTTGCCAACCAAGCACACGTACATATACTGTGCTTATTAAAGCCTTGTGCGATAGAGGTTTGATTGATAAAGCT
TTTAACTTGTTTGATGAGATGATTCCTAGAGGGTGTAAACCAAACGTCCACACTTACACTGTTTTGATTGATGGGTTGTG
TAGAGACGGAAAGATTGAAGAGGCTAATGGGGTTTGTCGAAAGATGGTTAAAGACAGGATATTTCCTAGTGTAATAACTT
ACAATGCGTTGATAAATGGCTACTGCAAAGATGGACGGGTTGTTCCCGCTTTTGAGCTTCTTACTGTAATGGAGAAGAGG
GCTTGCAAACCAAATGTAAGAACTTTTAACGAGCTTATGGAAGGGTTGTGTAGAGTCGGGAAACCGTACAAGGCTGTGCA
CCTTTTGAAGAGAATGCTGGACAATGGCCTGTCACCTGACATTGTGAGCTATAATGTTTTGATCGATGGGCTTTGTAGAG
AAGGCCATATGAATACGGCTTACAAGCTACTTAGCTCGATGAACTGCTTTGACATTGAGCCTGATTGTCTTACATTCACC
GCTATAATAAATGCTTTCTGCAAACAAGGGAAGGCTGACGTTGCTAGCGCGTTTTTAGGTTTGATGCTTAGAAAAGGAAT
AAGCCTAGATGAAGTAACAGGTACAACTCTTATCGATGGTGTCTGTAAAGTCGGTAAAACCCGTGACGCATTGTTTATCC
TGGAGACATTGGTTAAAATGAGAATTTTGACAACTCCTCACTCCCTGAATGTGATTCTTGATATGCTCAGTAAAGGTTGT
AAAGTGAAGGAGGAATTAGCAATGCTTGGGAAAATCAATAAGCTTGGTTTAGTTCCTTCTGTGGTGACATACACAACATT
GGTTGATGGGTTGATTCGATCAGGTGATATTACTGGTTCCTTCAGGATCCTAGAACTGATGAAGTTAAGTGGGTGTTTGC
CGAATGTCTATCCATACACAATCATCATAAATGGTCTTTGTCAATTTGGAAGAGTCGAGGAAGCAGAGAAGCTTCTTTCT
GCTATGCAAGATTCAGGAGTTTCACCAAACCATGTCACTTATACCGTTATGGTGAAAGGATATGTCAACAATGGAAAACT
AGACCGTGCTCTTGAAACAGTAAGAGCAATGGTTGAAAGAGGATATGAACTAAATGACCGTATCTATTCTTCATTGTTAC
AGGGATTTGTCTTATCTCAAAAGGGTATTGATAATTCAGAAGAGAGTACAGTTTCCGATATTGCTCTTAGAGAAACCGAT
CCTGAATGTATCAACGAACTCATATCTGTGGTTGAACAACTTGGTGGGTGTATCAGCGGGTTATGTATTTTCTTGGTCAC
ACGGTTATGCAAAGAGGGAAGAACGGATGAGTCCAACGATCTAGTCCAAAATGTACTCGAGAGAGGTGTTTTTCTTGAGA
AGGCCATGGACATCATTATGGAATCTTATTGCAGCAAGAAGAAACACACCAAGTGTATGGAGCTGATAACACTTGTTCTC
AAATCCGGATTTGTCCCGAGTTTCAAATCCTTCTGCCTAGTGATTCAAGGTTTGAAGAAGGAAGGAGATGCAGAGCGGGC
GCGGGAGCTTGTAATGGAGCTTCTTACCTCAAATGGAGTTGTAGAGAAAAGTGGAGTGTTGACTTATGTTGAGTGTCTCA
TGGAAGGAGATGAAACTGGTGATTGCAGTGAAGTCATAGATTTGGTTGATCAATTGCACTGCAGAGAAAGACCCACCTTC
TAA