Details for Arabidopsis Locus AT3G07250

Position : Chr3 ( 5`- 2300579 .. 2308305 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07250

Protein [Map View]
MAEKFVEDENVEVELELELCLSLGGPFKKTEKSKTFGQSNAVGFEKDNGVNLDGRTTNVTRIKETRKKREAKQQQRSGEE
GECKRIRTEYNGVSNGDDMDLSSINMCNGYGSGRLKESSKDVTIGSPICTSSSVSDPSSSSRQEGGSGDIGAQSGQTKQV
RSPVNNILTGTEQTVHNTDGSKDAETQEWSNSSVTKESGKPPKPHTNSNGNGSLLPFAQMPCVTSTGNGPEGKTVNGFLY
RYSKSEISIICVCHGTSFSPAEFIVHAGGTNVSHPLRHITVGDEFARQYYNTLQNAPENLYKLYKDKSTISRPGLDGTMR
VFTLSKDLKWRSPGSFDSVKITSVTSQDSLKQGILVVVYGYLTFNERPARHFTQVFFLVPQEKGYIVCTDMFRFVDIPEA
NAAIPPANDVIEEKVPETEGAALRVSEPNHGFDNVPKLSCASEGAAICAKKLPLDATIAFVENAFKQFGEIRRGGVEVRI
NWHCTGKYAYVEFEEAEAANRAIMASPISIDGYRTYVEKKYAYNKNIKADAGADTGNGNSQDSQAITEDAHIRVKDLPPN
ATVALVESVFKQFGPIKKGRIRVINPANSNYWYAFVEFEEADAAKRAIQASPLNVDGHTTYVEQKQPYYEGYYESPSDGP
GNIKRGEGVRGSLGNPICNWQKMEEVRGTDVYDLQNWQKIMNQSEEQMKFQEEEGRQYNQNRYTSEEVRGTEGVGLEEEE
EEEENQNWEEQRKIQEEEGTESHEASVFLKRLPLDVTFALIEDALKKFGPINAISIIKSGPLYKFAFVDFEKADVANRAI
MASPVRICEKNVNVQKKLSAGAGKRYTRPTCRDTSVPLGAGHREQGSQNRYGSEQVRGTEAFDFWDWQWQKSKEEQSKLQ
EEEGEIQVDHSWEEEHSKVLEEESKLQEEAVETQVDHSWDYEQIMEEQEEEESKQNQTSYIEDIAAFFSEHYYNNLQNSP
EILPGYYKDVSKITRPGLDGTMRSSTLPDIIEDLDMLSPGGFDSVEVTSVMSQDSHDKGIRVAVDGYFTFNERPARNFTQ
NFTFAPQEKGLFVSTDMFKFVGIPEANATIPPANNAAICVKNLPLNATIALVENAFKQFGEIRRGGVEVRNKRSFSYGFV
EFKEENAAQRAIKASPVTIDLRSVYVEKKRPDYIRYWDTPSTGPGIIYRSEGMSVTKDYGNKGGNENNQEPRALYAAVHV
KNLPPNVTTDWVENAFKQFGPIKRGGVQVSNRGVGNWFGNVKFVHAAAAERAVNPQVLLIMLPGMNLIQASPLLIGRRKL
KVKKKLDQRVQNQN*

DNA
ATGGCAGAAAAGTTTGTAGAAGATGAGAATGTGGAGGTCGAGCTCGAGCTCGAGCTATGTCTTTCCCTGGGAGGTCCTTT
CAAGAAAACGGAGAAATCTAAAACATTTGGACAATCTAACGCCGTCGGATTCGAGAAGGATAACGGCGTTAATCTTGACG
GCAGAACGACGAATGTGACGAGGATAAAGGAAACACGGAAGAAGCGGGAGGCGAAGCAGCAGCAGAGAAGCGGAGAAGAA
GGAGAGTGCAAGAGGATCAGAACAGAATATAACGGAGTTAGTAACGGCGATGATATGGATTTGAGCTCTATCAACATGTG
TAACGGTTACGGGTCGGGTCGACTCAAGGAAAGCAGTAAAGACGTTACGATTGGGTCACCCATTTGCACCTCCTCCTCCG
TATCCGATCCTAGCAGCTCTTCTCGCCAAGAAGGTGGAAGTGGCGACATTGGGGCACAATCTGGCCAAACCAAACAGGTT
AGATCTCCGGTTAACAACATTCTGACCGGTACAGAGCAAACCGTGCATAACACAGACGGTTCAAAAGACGCGGAGACCCA
AGAATGGTCCAACTCTTCTGTAACCAAAGAGAGTGGGAAGCCGCCAAAACCGCATACCAACAGTAACGGTAACGGCAGTT
TGCTTCCGTTTGCTCAGATGCCTTGCGTGACTAGCACCGGTAACGGTCCCGAGGGCAAAACCGTAAATGGTTTTCTATAC
CGTTACTCAAAATCAGAGATCAGTATAATCTGCGTCTGCCATGGAACGTCTTTCTCGCCGGCTGAGTTCATCGTTCACGC
CGGTGGGACTAATGTGTCGCATCCGTTGAGGCATATAACCGTGGGGGATGAGTTTGCAAGGCAGTACTATAACACCTTGC
AAAACGCCCCGGAGAATCTCTATAAGCTTTATAAAGATAAGAGTACGATTTCACGGCCTGGACTAGATGGAACGATGCGT
GTCTTCACTTTATCGAAAGATCTTAAATGGCGATCTCCTGGTAGTTTTGATTCGGTTAAGATAACCAGCGTCACGTCCCA
AGACTCTCTTAAGCAGGGTATCCTCGTCGTTGTTTATGGCTACCTCACTTTCAACGAGAGACCTGCAAGGCACTTCACAC
AAGTTTTCTTTCTTGTTCCCCAAGAAAAAGGCTACATTGTTTGCACCGACATGTTCAGGTTTGTTGATATACCCGAGGCC
AATGCAGCCATTCCTCCTGCTAATGATGTCATAGAGGAGAAAGTTCCAGAAACGGAGGGAGCTGCTCTGAGAGTTTCTGA
ACCAAATCATGGTTTTGATAATGTTCCCAAGCTATCTTGTGCTTCTGAGGGTGCAGCCATTTGCGCTAAAAAACTTCCTC
TAGATGCAACCATTGCCTTTGTTGAGAATGCATTTAAGCAGTTTGGAGAAATTAGAAGAGGTGGAGTTGAAGTTAGAATC
AACTGGCACTGTACTGGGAAATATGCTTATGTGGAGTTTGAAGAAGCAGAGGCCGCTAACAGGGCAATAATGGCGTCTCC
TATAAGTATTGATGGGTACAGAACTTACGTGGAGAAGAAGTACGCTTACAATAAAAATATAAAAGCTGATGCAGGTGCTG
ATACTGGAAATGGGAACAGTCAGGACTCTCAAGCTATAACTGAAGATGCACACATTCGTGTAAAAGACCTTCCTCCAAAT
GCAACCGTTGCCTTGGTTGAGAGTGTATTTAAGCAGTTTGGACCAATTAAAAAGGGACGAATTCGAGTTATAAACCCTGC
TAATTCGAACTATTGGTATGCTTTTGTGGAGTTTGAGGAAGCAGATGCTGCCAAGAGAGCAATACAGGCGTCTCCTCTAA
ATGTTGATGGCCACACAACTTACGTGGAGCAGAAGCAACCATACTATGAAGGTTACTATGAAAGTCCATCCGATGGACCA
GGAAACATAAAGAGAGGCGAGGGAGTGAGAGGATCACTAGGTAATCCCATTTGTAACTGGCAGAAGATGGAGGAAGTGAG
AGGAACAGATGTTTATGACTTGCAAAACTGGCAAAAGATTATGAATCAATCGGAGGAGCAGATGAAGTTTCAGGAGGAAG
AAGGGCGACAATACAATCAAAACAGATATACAAGCGAGGAAGTGAGAGGAACAGAAGGAGTTGGTCTGGAGGAAGAAGAA
GAAGAAGAAGAGAACCAAAACTGGGAGGAACAGAGGAAGATTCAGGAGGAAGAAGGAACAGAATCTCACGAAGCGTCCGT
TTTCCTTAAACGTCTTCCTCTAGATGTAACCTTTGCCTTGATTGAGGATGCATTGAAGAAGTTTGGACCAATTAATGCCA
TTTCAATTATAAAATCTGGTCCGCTCTATAAATTTGCTTTTGTGGACTTCGAGAAAGCAGATGTCGCCAACAGGGCAATA
ATGGCGTCTCCTGTGAGGATTTGTGAGAAAAACGTTAACGTGCAGAAGAAGCTAAGTGCAGGTGCAGGGAAGCGTTACAC
AAGACCAACCTGCAGAGACACCTCGGTGCCGCTAGGTGCAGGTCACAGGGAACAGGGAAGTCAAAACAGATATGGAAGCG
AGCAAGTGAGAGGAACAGAAGCTTTTGACTTTTGGGACTGGCAGTGGCAGAAGTCAAAGGAGGAACAGAGTAAGCTTCAG
GAGGAAGAGGGAGAAATACAAGTTGATCATTCTTGGGAGGAGGAACATAGCAAGGTTCTGGAGGAAGAGAGTAAGCTTCA
GGAGGAAGCGGTAGAAACACAAGTTGATCATTCTTGGGACTATGAGCAGATAATGGAGGAGCAAGAAGAGGAAGAATCAA
AACAGAACCAGACTAGTTATATTGAAGATATTGCGGCTTTTTTTTCGGAGCACTACTATAACAACTTGCAAAACTCCCCG
GAGATTCTCCCTGGCTACTATAAAGATGTCAGTAAGATTACACGGCCTGGACTTGATGGAACGATGCGTTCCTCTACCCT
ACCGGATATAATCGAGGATCTTGATATGCTATCTCCTGGTGGTTTTGATTCGGTTGAGGTAACCAGTGTCATGTCCCAAG
ACTCTCATGACAAGGGTATTCGCGTTGCTGTTGATGGCTACTTCACTTTCAACGAGAGGCCTGCAAGGAACTTCACACAA
AACTTCACTTTTGCTCCCCAAGAAAAAGGCCTCTTTGTTTCGACTGACATGTTCAAGTTTGTTGGCATACCCGAGGCTAA
TGCAACCATTCCTCCTGCTAATAATGCCGCAATTTGCGTTAAAAATCTTCCTCTAAATGCAACCATTGCCTTGGTTGAGA
ATGCATTCAAGCAGTTTGGAGAAATCAGAAGAGGTGGAGTTGAAGTTAGAAACAAAAGGAGCTTTTCTTATGGCTTCGTG
GAGTTTAAGGAAGAAAATGCCGCCCAGAGAGCAATAAAGGCTTCTCCTGTAACGATTGATTTGCGTAGCGTTTACGTGGA
GAAGAAGCGACCTGACTATATACGATACTGGGATACTCCATCCACTGGACCAGGAATCATATACAGAAGCGAGGGAATGA
GCGTAACAAAAGATTATGGTAATAAGGGTGGAAATGAGAATAATCAAGAGCCTCGAGCGTTATATGCTGCAGTTCACGTT
AAAAACCTTCCTCCAAATGTAACCACTGACTGGGTAGAGAACGCATTTAAGCAGTTTGGACCAATCAAAAGAGGAGGAGT
TCAAGTTTCTAACCGTGGTGTGGGCAATTGGTTTGGTAATGTGAAGTTTGTGCATGCAGCTGCTGCCGAGAGAGCAGTAA
ATCCACAAGTGTTATTGATAATGCTGCCTGGCATGAATCTTATTCAGGCGTCTCCTCTGTTGATTGGTCGGCGAAAACTT
AAAGTGAAGAAGAAGCTTGATCAGCGAGTGCAGAATCAGAACTGA