Details for Arabidopsis Locus AT3G07230

Position : Chr3 ( 5`- 2299774 .. 2300267 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07230

Protein [Map View]
MIYDVNSGLFRSFLSQKGSSSDKRKMEDKPREQKPKASDNKPVMNE*

DNA
ATGATCTATGATGTGAACTCTGGTCTATTCAGATCCTTCCTGAGCCAGAAGGGTAGCTCGTCCGACAAAAGGAAAATGGA
AGATAAGCCAAGAGAACAGAAGCCCAAAGCCAGCGACAACAAACCTGTTATGAATGAATGA