Details for Arabidopsis Locus AT3G07200

Position : Chr3 ( 5`- 2290762 .. 2292492 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07200

Protein [Map View]
MASRVVRTSMRLRRRDGVTQNEHQGDQQVADQAPTVPQIVATPPRINVVAIEDDDDVVESTASAFAQAKNKSRSARRGSQ
VVDVESAGANRSTRRRSDQTSVDSVELNKPRKSKAVAPPVEEPKFSCPICLCPFTQEVSTKCGHIFCKKCIKNALSLQAK
CPTCRKKITVKDLIRVFLPTTR*

DNA
ATGGCTTCTCGGGTGGTGAGGACTAGTATGAGACTTCGAAGGAGGGATGGTGTGACTCAAAACGAACACCAGGGAGATCA
ACAAGTGGCTGACCAAGCTCCAACGGTGCCTCAGATTGTGGCTACTCCTCCTAGGATCAATGTGGTTGCTATTGAAGATG
ATGATGATGTTGTTGAATCAACTGCTTCTGCTTTTGCTCAGGCTAAAAACAAATCGAGAAGTGCACGCAGAGGATCACAA
GTAGTTGATGTGGAGTCAGCTGGTGCTAATAGATCCACAAGGCGTCGCTCTGATCAAACTAGTGTTGACTCAGTTGAGCT
TAACAAGCCGAGAAAGTCCAAGGCTGTGGCTCCTCCTGTAGAGGAACCAAAATTTAGCTGTCCAATCTGTCTGTGTCCAT
TTACTCAGGAGGTTTCAACGAAATGTGGTCATATTTTCTGCAAAAAGTGCATAAAGAATGCGTTATCCCTCCAAGCTAAA
TGCCCGACATGTAGGAAAAAAATCACTGTTAAGGACCTTATCCGGGTCTTCCTTCCAACCACCAGATGA