Details for Arabidopsis Locus AT3G07190

Position : Chr3 ( 5`- 2285777 .. 2287447 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07190

Protein [Map View]
MIQLLFLVLFVEGAIAFLLLVKIGPLRELVMKSLDQLKLGKRPATLKTIAGTMSVILLSNLMNIIKIQNKGAKLGTMSPM
DQVLWRTHLLEASLMGVVLFFGFIIDRTHHYLEKLITLRSNVGSSKGELEELRKERIELKEKEEKTSKEIKQLKEKLSCV
SENLKKLEKESKEKETKLETAEAHVTALQKQSSELLLEYDRLLEDNQNLQSQILVGTKKT*

DNA
ATGATTCAGTTACTATTCCTGGTTCTGTTCGTAGAAGGTGCGATTGCGTTCTTACTACTGGTAAAGATTGGTCCTTTAAG
GGAGCTTGTAATGAAGAGCTTAGACCAGCTTAAATTGGGGAAACGTCCTGCTACTCTGAAAACCATCGCTGGAACCATGT
CTGTGATCCTCCTGTCGAATCTCATGAATATCATTAAGATCCAGAACAAGGGTGCCAAACTTGGGACAATGTCTCCAATG
GATCAAGTCCTCTGGAGAACACACTTGCTCGAGGCTTCTCTTATGGGTGTTGTGCTCTTTTTTGGCTTCATTATTGACCG
GACACATCATTACCTCGAAAAGCTAATCACTTTAAGAAGCAATGTCGGGTCATCGAAAGGAGAACTAGAAGAACTTAGGA
AGGAGAGAATCGAACTGAAGGAGAAAGAAGAGAAGACATCCAAGGAAATTAAGCAGCTGAAAGAAAAACTGTCGTGTGTT
TCAGAGAATCTCAAGAAACTAGAGAAGGAATCCAAAGAGAAAGAAACGAAGCTCGAAACAGCTGAAGCCCATGTCACAGC
TCTCCAAAAGCAGTCTTCAGAGCTATTGTTGGAGTATGACAGATTGCTAGAAGACAACCAAAATCTCCAAAGCCAGATTT
TGGTTGGAACCAAGAAAACCTGA