Details for Arabidopsis Locus AT3G07170

Position : Chr3 ( 5`- 2280194 .. 2282339 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07170

Protein [Map View]
MYADKLEAESGSRKVVKDRINGGSGDISTRVRQVTGKRQRQDDKWEHDLFSSDKPQLSNRRVDPRDLRLKLQKRHHGSQS
GREAGSGVRDLRDQLSGTMNQQPKNSDPPKSKAEAARPSMKSVATETETRKTSSQATRKKSQQADSSVDSFLESLGLEKY
STAFQVEEVDMDALMHMTDDDLKAMLIPMGPRKKILLALGSKP*

DNA
ATGTATGCTGATAAATTGGAGGCTGAGTCTGGAAGCAGGAAGGTCGTTAAGGATCGTATCAATGGCGGTTCTGGAGACAT
CTCTACTCGCGTGCGACAAGTGACTGGGAAGAGGCAAAGGCAGGACGACAAATGGGAGCATGATCTTTTCAGTAGTGACA
AACCTCAACTTTCAAATCGCAGGGTTGATCCTAGAGATCTTCGTTTGAAGCTCCAAAAGAGACATCATGGGTCTCAAAGT
GGGCGAGAAGCTGGTTCAGGCGTGCGGGATTTACGGGATCAGCTCTCTGGGACAATGAATCAGCAACCAAAAAACAGTGA
CCCACCAAAATCCAAAGCGGAGGCTGCTAGGCCAAGTATGAAGAGCGTAGCGACTGAAACAGAGACTAGAAAAACTTCCA
GTCAAGCTACCAGGAAGAAATCACAGCAGGCTGATTCATCGGTTGATAGCTTTCTTGAATCATTGGGTCTCGAGAAATAT
TCAACAGCGTTTCAAGTGGAAGAAGTTGATATGGATGCTCTCATGCATATGACAGATGATGACCTCAAGGCTATGCTCAT
ACCGATGGGTCCGAGGAAGAAGATACTTCTTGCTTTGGGATCTAAACCCTAA