Details for Arabidopsis Locus AT3G07150

Position : Chr3 ( 5`- 2263806 .. 2264576 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07150

Protein [Map View]
MAGDSGRRKIKLFCPSVSKIVEWVAWNDEKLDFRAIAAAFGLEPSTVKLNGHFISRGFDLVATCVTWQSLLTFFSARGLS
TGKHEADALLVHGKLSKLGTKRARSDPLEDFACNDLGLIKTKKLKDKCSVGESLISGCNKRKLLSEDSHPLKKLKLNMDD
SFGGSGSKTPLKCSFMSDNGLKRTREDDMIASASCKKIR*

DNA
ATGGCGGGAGACTCAGGTCGGAGGAAGATCAAACTTTTCTGTCCCTCGGTATCGAAGATTGTGGAGTGGGTTGCTTGGAA
CGACGAGAAACTAGACTTTAGAGCCATAGCCGCAGCGTTTGGGCTCGAACCATCAACGGTGAAGCTCAATGGTCACTTCA
TAAGCAGAGGTTTTGATCTAGTTGCCACTTGTGTGACGTGGCAGTCTTTGCTCACTTTCTTCTCTGCTAGAGGCTTGTCT
ACTGGAAAACACGAAGCCGATGCTCTGCTAGTTCACGGCAAGCTCTCTAAACTCGGTACTAAAAGAGCACGCTCGGATCC
TCTGGAGGACTTCGCCTGCAATGATCTTGGTCTAATCAAAACGAAGAAGTTGAAAGATAAGTGCTCAGTTGGAGAATCAC
TGATCTCTGGATGCAACAAGAGAAAGCTGTTGTCTGAAGATTCACACCCACTCAAGAAACTAAAACTCAACATGGATGAT
AGTTTCGGAGGGAGCGGATCTAAAACGCCATTGAAATGCAGTTTCATGAGTGATAATGGTCTGAAGAGGACAAGAGAAGA
TGATATGATTGCTTCTGCATCTTGTAAGAAGATAAGATGA