Details for Arabidopsis Locus AT3G07140

Position : Chr3 ( 5`- 2261192 .. 2263737 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07140

Protein [Map View]
MASLLRSLILLLIVQSFLVAIAFGSKEVEEFSEALLLKPLPDRKVLAHFHFENRAPPSNSHGRHHHLFPKAISQLVQKFR
VKEMELSFTQGRWNHEHWGGFDPLSSMNAKPVGVELWAVFDVPQSQVDTSWKNLTHALSGLFCASINFLESSTSYAAPTW
GFGPNSDKLRYGSLPREAVCTENLTPWLKLLPCRDKDGISALMNRPSVYRGFYHSQRLHLSTVESGQEGLGSGIVLEQTL
TVVLQPETTSVESNMQPSWSLSSLFGRQVVGRCVLAKSSNVYLQLEGLLGYESKNVDTEIEAHQLWKNAEFELSLKPERV
IRESCSFLFIFDIDKSSDSEPFDLGLTWKRPSKWSCQQAPLHSSRFLMGSGNERGAIAILLKATESQEKLSGRDLTNGQC
TIKANIFQIFPWYIKVYYHTLQIFVDQQQKTDSEVLKKINVSPSTDKVSSGMMEMMLELPCEVKSVAISIEYDKGFLHID
EYPPDANQGFDIPSALISFPDHHASLDFQEELSNSPLLSSLKEKSLVRSYTEVLLVPLTTPDFSMPYNVITITCTIFALY
FGSLLNVLRRRIGEEERFLKSQAGKKTGGLKQLLSRITAKIRGRPIEAPSSSEAESSVLSSKLILKIILVAGAAAAWQYF
STDE*

DNA
ATGGCTAGTCTTCTTCGATCCTTAATCCTTTTGCTAATCGTGCAATCATTTTTGGTTGCGATCGCTTTCGGGTCGAAAGA
AGTTGAAGAATTCAGCGAGGCATTGCTCTTGAAGCCTTTACCTGATCGAAAAGTTTTAGCTCACTTCCACTTCGAGAACC
GAGCTCCTCCGTCAAACTCCCATGGCCGCCATCACCATCTCTTCCCGAAAGCTATTTCTCAGTTGGTTCAGAAGTTTCGG
GTCAAGGAGATGGAGTTATCTTTTACTCAGGGTCGATGGAACCATGAACATTGGGGAGGATTTGACCCTCTATCAAGTAT
GAATGCGAAGCCTGTTGGTGTGGAGCTGTGGGCTGTGTTTGATGTTCCTCAGTCTCAGGTTGATACTTCTTGGAAGAACT
TAACTCATGCACTGTCAGGGCTTTTCTGTGCTTCCATCAATTTTCTAGAATCTTCCACTTCATATGCTGCTCCTACATGG
GGATTTGGACCCAATTCTGACAAGCTGAGGTATGGTTCACTGCCACGTGAAGCTGTTTGTACTGAGAACTTGACCCCATG
GCTAAAGTTACTTCCTTGTAGAGATAAGGATGGTATTTCTGCGTTAATGAATAGGCCATCTGTTTACAGAGGGTTTTATC
ATTCTCAGAGATTGCATTTATCCACGGTTGAATCTGGTCAAGAGGGATTGGGTTCTGGTATAGTGCTGGAGCAGACGCTT
ACTGTTGTTCTTCAGCCTGAGACTACTTCTGTTGAATCAAATATGCAGCCAAGTTGGTCCCTCAGCTCCCTCTTTGGGAG
ACAAGTTGTTGGGAGATGTGTTCTTGCAAAGTCAAGTAATGTGTATCTTCAATTGGAAGGTCTTCTTGGTTACGAATCAA
AAAACGTGGATACAGAAATAGAAGCACACCAACTATGGAAGAATGCAGAGTTTGAATTGTCTCTTAAGCCAGAGAGGGTT
ATTCGAGAAAGCTGCAGCTTTCTTTTTATTTTTGATATTGACAAATCAAGTGACAGCGAGCCATTTGATCTTGGCCTTAC
TTGGAAGCGTCCCTCAAAGTGGTCATGTCAACAAGCTCCATTACACTCGAGTCGGTTTTTGATGGGAAGCGGGAACGAAA
GAGGTGCAATAGCCATCTTGTTAAAAGCGACAGAATCTCAGGAGAAGTTATCAGGCAGAGATCTCACTAATGGCCAATGT
ACAATAAAAGCAAATATCTTCCAGATTTTCCCATGGTATATTAAGGTTTATTATCATACTCTACAAATCTTTGTGGATCA
ACAACAGAAGACAGACAGTGAGGTCTTAAAGAAGATCAATGTCTCACCATCTACGGATAAGGTGTCATCTGGCATGATGG
AGATGATGTTGGAACTACCATGTGAAGTGAAATCTGTAGCCATATCAATTGAATATGATAAGGGTTTTCTGCATATAGAT
GAATATCCTCCTGATGCTAATCAAGGATTCGACATTCCATCGGCTTTGATAAGCTTCCCCGATCATCATGCTAGTTTAGA
TTTCCAAGAAGAGCTCAGCAACTCGCCCTTATTATCAAGTTTAAAGGAAAAATCCTTAGTACGCTCTTACACAGAAGTAT
TGCTCGTACCTTTGACAACCCCTGATTTTAGCATGCCTTACAACGTAATCACGATCACATGCACCATCTTCGCATTGTAT
TTTGGATCATTGCTAAATGTTCTACGTAGACGAATTGGTGAAGAAGAAAGGTTTCTCAAAAGCCAAGCAGGAAAGAAAAC
AGGTGGGCTTAAGCAGTTATTATCGAGAATCACAGCCAAGATTAGAGGGAGACCAATTGAAGCACCATCATCATCAGAAG
CTGAATCTTCGGTCTTGTCTAGTAAACTTATCTTAAAAATCATATTAGTTGCAGGAGCTGCTGCAGCGTGGCAATATTTT
TCCACGGACGAGTAG