Details for Arabidopsis Locus AT3G07060

Position : Chr3 ( 5`- 2232606 .. 2237118 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07060

Protein [Map View]
MSNRSLHLKKISWLSSRILSDNVHGRFRRSITTPATCLAPSLDGDMNIGSKTLVEQRFSRGFASVRRVSRASSSSSSSPS
SPHVDLLSFIKASLDKLEGPSHHWLNRDFGNKQLFKDKGTYVVLAGHLLDGTSDLSGFFEKLKLLQQRSPGVCFMGIHFS
DQARIADDRTALAELILKEYLTFPVLLSEKEFPKTSGEVRYIVFKDFKNPLIYEEKDLDIASVVKALDSLLTQDTEKSKS
VRLFTNTWSKQAEAIKESHFPSFFQDLLLYFPGCISADEVGDRLFLSDTNHHRIIIFENSGKIVDSIGCFPGFEDGDFES
AKMLRPTGTLYDEAEDCLYIVDSENHAIRRANINSRVLETVYPKVIKKTGGLWSWIMEKMGLGKDDDTTVDADTKSEEFD
ARSLLFPWHILKRDDESLLVINKSFSKLWIINFASGEIEEVVEGFSKIIEICGQSITEKLSVLEHMPSNWLQQQTAAIAS
FKEQPSASLLSSFTKLGDDIVMTDIACQRVLKLNRDSGACSSIQFSNSGILGLPYWLFIPLERVFNLANGVQEAHLSHTQ
ELRLLPGKISIRLNIEIPPCTELVEPIQESCIWRQTRGAISEFSSAGSAVEPSEKIGVSQQWYDELDSLAKEIANPEAAE
EEEEEDVNPSEVDREEDGRIHIDCPVKTSPGSSELIVYAALYLRLARNEETESATQEELARKIAKILKPVRNITTMKEDL
FVNLLSKSKRELRDIVFIKPMHVRIRLDSKDHPKADNSRDVILTDSSVEVDVSL*

DNA
ATGTCTAACAGAAGCCTCCATTTGAAGAAAATATCATGGCTTTCTTCTCGGATTCTCTCAGACAATGTTCACGGTCGATT
TCGCCGATCAATCACTACTCCAGCCACTTGTTTAGCTCCTTCACTCGATGGAGACATGAACATTGGATCCAAGACATTGG
TCGAACAACGTTTCTCTCGCGGATTTGCATCAGTACGACGAGTATCTCGAGCTTCTTCTTCTTCTTCTTCTTCTCCTTCC
TCTCCACATGTTGATTTGCTCTCTTTTATTAAAGCTTCACTTGATAAACTTGAAGGTCCTTCCCATCATTGGTTGAATCG
AGACTTTGGGAATAAACAGCTTTTCAAGGACAAAGGAACTTATGTAGTTCTAGCTGGACATTTGCTAGACGGAACAAGTG
ATCTGAGTGGTTTCTTTGAGAAACTAAAGTTGCTTCAGCAGAGGTCTCCGGGTGTCTGTTTCATGGGCATCCACTTCAGT
GATCAAGCTCGAATCGCTGATGATCGAACTGCTCTAGCTGAGTTGATTTTGAAGGAATACCTCACTTTTCCTGTGCTACT
TTCCGAAAAAGAATTTCCCAAGACAAGTGGGGAAGTACGTTACATCGTGTTTAAAGATTTTAAGAATCCTCTAATCTACG
AAGAGAAGGATCTTGATATTGCTTCTGTAGTTAAAGCTCTTGACAGCCTCCTCACTCAAGATACTGAGAAATCCAAGTCT
GTCAGACTTTTCACGAACACTTGGTCAAAACAAGCAGAGGCTATCAAGGAATCACATTTCCCTTCTTTCTTTCAGGATTT
GTTACTTTACTTTCCAGGTTGTATCTCTGCAGACGAAGTTGGAGACCGTCTGTTTCTTTCTGATACCAACCATCATCGTA
TTATTATTTTCGAAAACAGTGGGAAGATTGTAGACAGTATTGGTTGTTTCCCAGGTTTTGAGGATGGAGATTTTGAATCT
GCAAAGATGTTACGTCCTACAGGGACCCTTTACGACGAAGCGGAGGATTGTCTTTACATTGTAGATTCTGAGAATCACGC
CATTAGAAGAGCAAATATAAATAGCCGGGTCCTGGAAACAGTATATCCAAAGGTTATTAAGAAAACTGGTGGCTTATGGT
CTTGGATAATGGAGAAAATGGGTCTTGGAAAAGATGACGATACAACAGTTGATGCTGATACCAAATCAGAAGAATTTGAT
GCACGCTCTCTTTTGTTTCCATGGCATATACTGAAGCGTGACGATGAGAGTCTTTTAGTCATTAACAAAAGCTTTTCGAA
GTTATGGATAATAAATTTTGCTTCAGGAGAGATCGAAGAAGTTGTGGAAGGGTTTTCGAAGATAATTGAGATCTGCGGTC
AATCAATCACAGAGAAGCTATCAGTGTTGGAACATATGCCTTCTAACTGGTTGCAACAGCAAACTGCGGCTATCGCCTCA
TTTAAGGAGCAGCCAAGTGCTTCCCTTTTGTCTTCTTTTACTAAACTTGGAGACGACATTGTCATGACAGATATAGCTTG
TCAGAGGGTGTTGAAGCTAAATAGAGATTCTGGAGCATGCTCTAGCATTCAATTCTCAAACAGTGGGATCCTTGGGTTGC
CCTATTGGTTGTTCATTCCACTGGAGAGAGTTTTTAATCTAGCTAATGGAGTTCAGGAAGCACATCTCAGTCATACTCAG
GAACTCCGGTTATTGCCAGGTAAAATTAGCATACGGTTGAACATAGAGATTCCTCCATGCACGGAGCTTGTTGAACCGAT
ACAAGAAAGCTGCATATGGCGACAGACAAGAGGCGCAATCAGTGAATTCTCGAGTGCTGGAAGTGCAGTTGAACCTTCAG
AAAAGATTGGAGTTTCACAACAATGGTATGATGAATTAGACAGCCTCGCCAAAGAAATAGCCAACCCTGAAGCAGCTGAG
GAAGAGGAAGAAGAAGATGTTAACCCCTCTGAGGTTGACAGAGAAGAAGATGGACGTATCCACATTGATTGTCCTGTCAA
AACAAGTCCTGGCTCAAGTGAGCTTATTGTTTATGCAGCTTTGTATTTAAGACTAGCGAGAAACGAAGAGACAGAAAGTG
CGACCCAGGAAGAACTGGCGAGAAAAATAGCAAAGATTTTAAAGCCAGTACGGAACATTACAACTATGAAGGAAGATTTG
TTTGTGAATTTGTTGTCCAAGTCAAAGAGAGAATTGAGAGACATTGTCTTCATAAAGCCGATGCATGTGCGGATAAGGTT
AGACTCGAAGGATCATCCAAAAGCCGATAACTCAAGAGACGTAATCTTGACTGACTCCTCTGTTGAGGTTGATGTCTCTC
TCTGA