Details for Arabidopsis Locus AT3G07050

Position : Chr3 ( 5`- 2229590 .. 2232361 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07050

Protein [Map View]
MVKRSKKSKSKRVTLKQKHKVLKKVKEHHKKKAKDAKKLGLHRKPRVEKDPGIPNDWPFKEQELKALEVRRARALEEIEQ
KKEARKERAKKRKLGLVDDEDTKTEGETIEDLPKVVNVRDNSERAFYKELVKVIELSDVILEVLDARDPLGTRCTDMERM
VMQAGPNKHLVLLLNKIDLVPREAAEKWLMYLREEFPAVAFKCSTQEQRSNLGWKSSKASKPSNMLQTSDCLGADTLIKL
LKNYSRSHELKKSITVGIIGLPNVGKSSLINSLKRAHVVNVGATPGLTRSLQEVHLDKNVKLLDCPGVVMLKSSGNDASI
ALRNCKRIEKLDDPVSPVKEILKLCPKDMLVTLYKIPSFEAVDDFLYKVATVRGKLKKGGLVDIDAAARIVLHDWNEGKI
PYYTMPPKRDQGGHAESKIVTELAKDFNIDEVYSGESSFIGSLKTVNEFNPVIIPSNGPLNFDETMIEDESKTQTEEEAE
HESDDDESMGGEEEEEAGKTKEKSETGRQNVKLYAAESMLNTKKQKAEKKKRKKAKKAGADEEDLMDGDYDFKVDYRKNK
DGEDEEFQIDAKIPMAGLLPEE*

DNA
ATGGTGAAACGGAGTAAAAAGAGTAAGAGTAAGAGGGTGACCTTGAAGCAGAAGCATAAGGTCCTGAAAAAGGTGAAGGA
GCACCACAAGAAGAAGGCAAAGGATGCTAAAAAGCTTGGCCTTCACCGTAAGCCAAGAGTAGAGAAAGACCCAGGTATAC
CCAATGACTGGCCTTTCAAGGAACAAGAGCTTAAAGCCCTTGAAGTTCGACGTGCCCGTGCTCTTGAGGAGATTGAACAG
AAGAAAGAAGCTCGCAAAGAAAGGGCCAAAAAGAGGAAACTTGGTTTGGTTGATGATGAGGATACCAAGACAGAAGGAGA
GACCATAGAGGACTTACCTAAAGTTGTCAATGTTCGAGATAACTCGGAGAGGGCTTTCTACAAGGAGCTAGTTAAAGTCA
TTGAATTGTCTGATGTCATTTTGGAGGTTCTTGATGCCCGTGATCCTCTTGGCACTCGTTGTACTGACATGGAGAGGATG
GTGATGCAAGCCGGTCCCAATAAGCATCTTGTGTTGCTGCTGAACAAGATTGATCTTGTTCCCCGAGAGGCTGCTGAGAA
ATGGCTTATGTACCTTAGGGAAGAATTTCCAGCTGTTGCCTTCAAGTGTAGCACCCAGGAACAGAGATCAAACTTGGGTT
GGAAATCATCTAAGGCATCAAAACCAAGCAATATGTTGCAGACGAGTGATTGTCTTGGAGCAGACACTCTTATCAAATTG
TTGAAGAACTACTCAAGAAGTCATGAGTTAAAAAAATCTATCACAGTTGGTATTATTGGACTGCCTAATGTCGGCAAGAG
TAGTCTTATTAACAGTCTGAAGAGAGCGCATGTTGTCAATGTTGGTGCCACTCCTGGACTGACTAGATCTCTGCAAGAGG
TTCACTTGGACAAAAACGTGAAGTTGCTGGATTGTCCTGGAGTTGTGATGTTGAAATCATCAGGAAATGATGCTTCCATA
GCTCTCCGAAATTGTAAAAGAATCGAGAAGTTGGATGACCCAGTTAGTCCAGTGAAGGAAATTCTCAAGCTTTGTCCTAA
AGATATGCTGGTGACTCTCTACAAAATCCCGAGCTTCGAGGCAGTTGATGATTTCCTTTACAAAGTCGCCACTGTAAGGG
GTAAACTTAAAAAGGGTGGTCTTGTGGATATTGATGCTGCTGCCAGAATTGTTTTGCATGACTGGAATGAAGGTAAAATC
CCATACTATACAATGCCGCCAAAGAGGGACCAGGGTGGACATGCAGAGTCAAAGATTGTGACTGAGCTGGCCAAGGATTT
CAACATCGATGAGGTTTACAGTGGTGAATCCTCTTTCATTGGGAGCTTGAAGACGGTTAACGAATTCAACCCTGTTATTA
TTCCTTCAAATGGTCCTCTCAATTTCGATGAAACTATGATCGAGGATGAGTCTAAGACGCAGACGGAAGAGGAGGCTGAG
CATGAGAGTGATGATGATGAGTCAATGGGAGGGGAGGAGGAGGAAGAGGCAGGAAAGACGAAGGAGAAATCAGAGACGGG
GAGGCAGAACGTGAAGCTATACGCAGCGGAAAGCATGTTGAATACAAAGAAACAGAAAGCAGAGAAGAAGAAGAGGAAGA
AAGCAAAGAAAGCAGGAGCTGATGAGGAGGATCTGATGGACGGAGATTATGATTTCAAAGTGGATTATAGGAAGAACAAA
GATGGAGAAGACGAAGAATTCCAGATTGATGCTAAAATCCCAATGGCTGGACTTTTGCCTGAAGAATGA