Details for Arabidopsis Locus AT3G07030

Position : Chr3 ( 5`- 2223001 .. 2225254 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07030

Protein [Map View]
MDRYQRVAKPKPESPINENEIRITSKGLIRNYISYATSLLQEKSVKDIVLKAMGQAISKTVAISEILKNKIPGLHQDIAI
SSISITDVWEPTEEGLFPVELTRHVSMISITLSLSELNKDSPGYQAPAQSDQSKPQYQPQQGRQARLPYNAYGEEGEVVA
EGEAGEEVDMETTKGVMKEKTKGTIKKIIKTMKVGIQTRAEAVDVVDEAMAIVGGRGGYGGGRDGGYGGGRDDGYGERRN
DGYGERRNDRYGGGRDDGYGGGRDDGYGGGRNDGYGGRRGGFRGGRGGGRDEGYGGGRGGYGGRSGGQGDGYGGGRGDGY
GGGRGDGYGGGRGDGYGGGRVDRYDGGRRDGYGGGRYDGYGGGKSDGYGGGRGGYRGGRGGYGRGRGRMGNGGRSRDGAS
NQNEA*

DNA
ATGGATAGATACCAGAGAGTCGCTAAACCGAAACCAGAGTCTCCGATTAACGAGAATGAGATCCGTATCACCAGTAAAGG
CCTTATCCGAAACTACATCAGTTATGCCACCAGTCTTCTTCAGGAGAAAAGTGTTAAAGACATTGTGTTGAAGGCAATGG
GGCAGGCAATCAGCAAGACTGTGGCTATCTCTGAGATACTAAAAAATAAAATCCCAGGTTTGCATCAAGATATTGCAATC
AGTTCTATTAGCATTACTGATGTCTGGGAGCCTACTGAGGAGGGTTTGTTTCCGGTGGAGTTGACGCGCCATGTTTCCAT
GATTTCAATCACATTGTCATTGAGCGAGCTAAACAAAGATTCTCCTGGGTATCAAGCTCCAGCACAGTCAGATCAGTCTA
AGCCTCAATATCAGCCACAACAAGGGAGACAAGCCCGCCTACCATACAATGCTTATGGTGAAGAGGGAGAGGTCGTGGCA
GAGGGAGAAGCAGGGGAAGAGGTGGATATGGAAACTACCAAGGGAGTTATGAAGGAAAAGACCAAGGGAACTATCAAGAA
GATTATCAAGACAATGAAGGTGGGTATTCAAACTCGGGCAGAGGCCGTGGACGTGGTGGACGAAGCTATGGCTATCGTGG
GTGGCAGAGGCGGGTATGGTGGTGGGAGAGATGGTGGATATGGTGGTGGGAGAGATGACGGGTATGGGGAAAGGAGAAAT
GACGGGTATGGGGAAAGGAGAAATGACAGGTATGGTGGAGGAAGAGACGACGGGTATGGTGGAGGGAGAGATGACGGATA
TGGTGGAGGCAGAAACGATGGATATGGGGGAAGAAGAGGCGGATTTCGTGGCGGTCGTGGTGGAGGCAGAGATGAAGGAT
ACGGTGGCGGCCGAGGTGGATATGGAGGTAGAAGTGGCGGCCAAGGTGATGGGTATGGCGGAGGCAGAGGTGACGGGTAT
GGTGGAGGCAGAGGTGACGGGTATGGTGGAGGCAGAGGTGATGGCTATGGTGGTGGCCGAGTTGATAGGTATGATGGAGG
AAGACGTGATGGCTATGGTGGAGGCCGATATGATGGCTATGGTGGGGGTAAAAGTGATGGTTATGGAGGTGGCCGAGGCG
GATACCGTGGAGGTAGAGGCGGATATGGTCGTGGACGTGGAAGGATGGGTAATGGTGGTCGTTCAAGGGATGGTGCTAGT
AACCAAAACGAAGCCTAA