Details for Arabidopsis Locus AT3G07020

Position : Chr3 ( 5`- 2217622 .. 2221702 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G07020

Protein [Map View]
MPEISPAELAKVSSSSSSSSSSSSGRASVKIEEIEGGAAASGVVIVSEELETNPKTVVASIADETVAESSGTGNKSFSRV
WTMPLEGSSSSDKAESSSTNQPRLDKSKTERQQKVTHILAEDAAKIFDDKISAGKKLKLLNRIATVKHDGTVEFEVPADA
IPQPIVVDRGESKNGVCADESIDGVDLQYIPPMQIVMLIVGTRGDVQPFVAIAKRLQDYGHRVRLATHANFKEFVLTAGL
EFYPLGGDPKVLAGYMVKNKGFLPSGPSEIPIQRNQMKDIIYSLLPACKEPDPDSGISFKADAIIANPPAYGHTHVAEAL
KIPIHVFFTMPWTPTSEFPHPLSRVKQPAGYRLSYQIVDSLIWLGIRDMVNDLRKKKLKLRPVTYLSGTQGSGSNIPHGY
MWSPHLVPKPKDWGPQIDVVGFCYLDLASNYEPPAELVEWLEAGDKPIYIGFGSLPVQEPEKMTEIIVEALQRTKQRGII
NKGWGGLGNLKEPKDFVYLLDNVPHDWLFPRCKAVVHHGGAGTTAAGLKASCPTTIVPFFGDQPFWGERVHARGVGPSPI
PVDEFSLHKLEDAINFMLDDKVKSSAETLAKAMKDEDGVAGAVKAFFKHLPSAKQNISDPIPEPSGFLSFRKCFGFS*

DNA
ATGCCGGAAATATCGCCGGCTGAGCTCGCCAAGGTTTCTTCCTCGTCTTCTTCTTCTTCTTCCTCAAGTTCCGGCAGAGC
GTCGGTGAAAATCGAAGAGATTGAAGGCGGTGCTGCTGCTAGTGGCGTCGTCATTGTTTCTGAAGAACTTGAGACCAATC
CCAAAACTGTTGTTGCCTCCATTGCTGATGAAACTGTCGCTGAATCTTCAGGTACTGGCAATAAAAGCTTTTCTCGAGTA
TGGACAATGCCATTGGAGGGTTCATCGAGCAGTGATAAGGCTGAATCATCATCAACAAACCAACCTAGGTTAGATAAATC
AAAGACTGAGAGGCAGCAAAAAGTTACTCACATTCTTGCTGAGGATGCTGCTAAGATTTTCGATGACAAAATCTCTGCAG
GGAAGAAGCTTAAATTGCTGAACCGTATAGCTACTGTGAAACATGATGGGACTGTTGAGTTTGAAGTTCCAGCAGATGCT
ATCCCTCAACCTATTGTTGTTGATCGTGGAGAATCGAAAAACGGTGTTTGCGCTGATGAGTCTATTGATGGGGTTGACCT
TCAGTATATCCCTCCTATGCAAATTGTGATGTTAATTGTTGGAACACGTGGAGATGTTCAACCTTTTGTTGCAATAGCCA
AACGGCTTCAGGACTATGGCCATCGAGTTAGACTTGCAACTCATGCAAATTTTAAAGAGTTTGTTTTGACTGCTGGATTA
GAGTTTTATCCTCTAGGTGGAGATCCAAAAGTGCTCGCCGGTTATATGGTTAAGAACAAGGGCTTTTTGCCATCAGGCCC
TTCAGAGATTCCAATTCAACGAAACCAAATGAAGGACATCATATATTCTCTACTTCCAGCATGTAAAGAACCTGATCCAG
ATTCTGGGATTTCCTTTAAAGCTGATGCAATTATTGCCAACCCTCCAGCGTATGGACATACCCATGTGGCAGAAGCACTG
AAGATACCGATTCACGTATTTTTCACCATGCCATGGACACCAACAAGTGAATTTCCACACCCATTGTCACGTGTCAAACA
ACCAGCAGGATACAGACTTTCATATCAAATCGTCGATTCATTGATCTGGCTTGGAATAAGAGATATGGTAAATGACCTTA
GGAAAAAGAAATTGAAACTACGGCCTGTTACATATCTAAGTGGAACACAAGGATCTGGATCTAATATCCCACATGGATAT
ATGTGGAGTCCTCACCTTGTACCAAAGCCAAAAGACTGGGGGCCTCAAATTGATGTAGTGGGATTTTGCTATCTTGATCT
TGCATCCAACTATGAACCTCCTGCAGAGCTTGTGGAATGGCTAGAAGCTGGTGACAAGCCCATATATATCGGCTTTGGTA
GTCTCCCTGTGCAAGAACCAGAGAAAATGACAGAAATCATTGTGGAAGCACTTCAAAGAACTAAACAGAGAGGAATCATC
AACAAAGGTTGGGGTGGCCTTGGAAACTTGAAAGAACCGAAGGACTTTGTTTACTTGTTGGATAATGTCCCACATGACTG
GCTATTCCCGAGATGCAAAGCTGTGGTTCATCATGGTGGTGCTGGAACAACGGCTGCGGGTCTTAAAGCCTCGTGCCCAA
CTACAATCGTGCCTTTCTTTGGAGACCAACCTTTTTGGGGAGAACGAGTGCATGCTAGAGGTGTTGGTCCTTCACCAATC
CCAGTGGATGAATTCTCACTTCATAAGCTTGAAGATGCCATAAATTTCATGCTCGACGATAAGGTAAAGAGCAGTGCAGA
GACACTAGCAAAGGCGATGAAGGACGAGGATGGTGTGGCTGGAGCCGTGAAGGCCTTCTTTAAACATCTTCCAAGTGCAA
AACAGAATATCTCGGATCCGATCCCAGAACCTTCTGGATTTCTCTCTTTCAGGAAATGCTTTGGCTTTTCTTGA