Details for Arabidopsis Locus AT3G06985

Position : Chr3 ( 5`- 2205392 .. 2205706 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06985

Protein [Map View]
MNCKIEFMSFLVMTSIVILFLFVSGKVEAEPQCIGSCEMLADCNTACIRMGYLFGQCVGWKTPDMCCCNH*

DNA
ATGAATTGCAAGATTGAATTCATGAGCTTCCTCGTGATGACTTCAATAGTCATCCTATTTCTCTTTGTTTCAGGGAAAGT
TGAAGCTGAACCCCAATGCATTGGATCATGTGAAATGCTTGCTGACTGTAACACGGCTTGTATCAGGATGGGATACTTAT
TTGGCCAATGCGTTGGCTGGAAAACTCCCGATATGTGTTGTTGCAACCATTGA