Details for Arabidopsis Locus AT3G06980

Position : Chr3 ( 5`- 2201467 .. 2204833 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06980

Protein [Map View]
MLARAPPPYFNFPARNNTICNRNEIVRLFRNGGGVVARGAGFTRRPLETSSSYDDSTDDGFVIISAADKENEFAPPPSSD
LLSSIPSESARRNGSRSRGLTASFGRLKAQKVKALVGKVTQKKQHMSHNEEEDEDDASDENYSADEGFGSSSILDLMRKK
LAMKAIPRSGKSAERNEVKRASKVRESRESRRDLDRLEGDDEDVDEVSNPDRFTDNQRAGSRSSYSKGGYAANSRGKGDR
LSVARDLDSFEGHGRAIDEVSNPRKFNDNERAESRSSYSRDSSANSRGREDRRFVAKELDTFQGRDKAYDEVYNPRRFTD
NERGLRGGSHSKGSDTNSRGWGDRRSVVYTRDMDDWRERNKTKDTRETGFFSRKTFAEIGCSEDMMKALKEQNFDRPAHI
QAMAFSPVIDGKSCIIADQSGSGKTLAYLVPVIQRLREEELQGHSKSSPGCPRVIVLVPTAELASQVLANCRSISKSGVP
FRSMVVTGGFRQRTQLENLEQGVDVLIATPGRFTYLMNEGILGLSNLRCAILDEVDILFGDDEFEAALQNLINSSPVTAQ
YLFVTATLPLEIYNKLVEVFPDCEVVMGPRVHRVSNALEEFLVDCSGDDNAEKTPETAFQNKKTALLQIMEENPVSKTII
FCNKIETCRKVENIFKRVDRKERQLHVLPFHAALSQESRLTNMQEFTSSQPEENSLFLVCTDRASRGIDFSGVDHVVLFD
FPRDPSEYVRRVGRTARGARGKGKAFIFVVGKQVGLARRIIERNEKGHPVHDVPNAYEFTT*

DNA
ATGTTGGCGAGAGCTCCACCGCCTTATTTTAATTTCCCGGCGAGGAATAATACTATCTGTAATCGGAATGAGATTGTGCG
GTTGTTTCGTAACGGCGGAGGAGTGGTAGCTAGAGGAGCTGGTTTCACTCGGCGACCACTGGAAACTTCGAGCTCTTACG
ACGATTCCACCGATGACGGATTCGTTATCATCAGTGCGGCAGATAAGGAGAATGAGTTCGCTCCTCCGCCTTCTTCCGAT
TTACTCTCTTCGATTCCGTCAGAATCTGCGAGAAGAAATGGTTCGCGTTCGAGAGGTCTGACTGCGAGTTTTGGAAGGTT
AAAGGCCCAGAAAGTGAAAGCTCTTGTTGGGAAGGTAACGCAGAAGAAGCAGCATATGAGTCACAATGAGGAAGAAGACG
AGGATGACGCCTCTGATGAGAATTATTCTGCGGATGAAGGGTTTGGTTCATCATCAATTCTGGATTTGATGAGGAAGAAG
CTGGCTATGAAGGCTATTCCTAGATCAGGAAAATCTGCAGAGAGGAACGAGGTAAAAAGAGCTAGCAAAGTGCGGGAATC
TAGAGAGTCAAGAAGAGATTTAGATAGATTGGAAGGAGATGATGAAGATGTTGATGAGGTTTCAAATCCTGACAGGTTTA
CTGATAATCAGAGAGCAGGGTCGCGGAGTTCATATTCAAAAGGTGGTTATGCTGCTAACTCCAGGGGTAAGGGTGATAGG
CTTTCGGTTGCAAGAGATTTAGATTCATTTGAGGGACATGGTAGAGCTATTGATGAGGTTTCAAACCCTCGAAAGTTTAA
TGATAACGAGAGAGCAGAATCAAGGAGTTCATATTCAAGAGACTCTTCTGCTAACTCCAGGGGTAGAGAAGATAGGCGTT
TTGTTGCCAAAGAGTTAGATACATTTCAGGGACGTGATAAAGCTTATGATGAGGTTTATAATCCTCGAAGGTTCACTGAT
AATGAGAGAGGACTCAGAGGAGGATCACATTCAAAAGGCTCTGATACTAACTCTCGGGGTTGGGGTGATAGGCGTTCTGT
TGTATATACAAGAGATATGGATGATTGGAGAGAGAGGAATAAAACCAAGGATACTAGGGAGACTGGCTTTTTTAGCCGGA
AAACTTTTGCAGAAATTGGATGTAGTGAAGATATGATGAAGGCCTTAAAGGAACAGAATTTTGATCGCCCGGCACATATT
CAGGCTATGGCTTTTTCACCAGTTATTGATGGAAAGAGTTGTATCATAGCTGACCAAAGTGGATCAGGCAAGACACTGGC
ATATCTTGTCCCTGTTATTCAGCGTCTCAGGGAAGAAGAGCTTCAAGGACACAGCAAATCGTCTCCTGGGTGTCCTCGTG
TCATTGTTCTGGTACCAACTGCAGAGTTGGCTTCTCAGGTTCTTGCTAACTGTAGATCAATATCAAAGTCTGGGGTCCCG
TTCCGTTCGATGGTAGTGACGGGTGGCTTCAGACAACGAACCCAGCTAGAAAATTTAGAGCAAGGTGTTGACGTTTTGAT
TGCAACACCAGGGCGTTTCACGTACCTAATGAACGAAGGAATTTTGGGGTTGTCAAATTTAAGATGTGCCATCTTGGATG
AGGTGGATATACTCTTTGGCGACGATGAGTTTGAGGCAGCCCTGCAAAATTTGATAAACTCTTCTCCTGTTACTGCACAG
TATCTATTTGTTACAGCAACCTTGCCACTTGAAATATACAACAAACTTGTTGAAGTTTTCCCTGATTGTGAAGTTGTAAT
GGGACCTCGAGTGCACCGTGTTAGTAATGCTCTCGAAGAGTTTCTTGTTGACTGTAGTGGAGATGATAATGCAGAGAAAA
CTCCTGAGACTGCATTTCAGAACAAGAAAACTGCTCTCCTTCAGATAATGGAGGAAAACCCTGTTTCCAAAACTATTATC
TTCTGCAATAAGATTGAGACATGTAGGAAAGTTGAGAACATATTTAAGCGGGTTGATAGAAAGGAAAGACAGTTGCACGT
CCTACCTTTTCATGCTGCACTCTCACAAGAGTCAAGGCTTACAAACATGCAAGAATTCACATCATCTCAGCCCGAAGAAA
ATTCACTGTTTCTGGTTTGCACTGATAGAGCCTCCCGTGGGATAGATTTCTCTGGTGTTGATCATGTGGTGCTCTTTGAC
TTCCCACGTGACCCCAGTGAATACGTGAGACGTGTAGGAAGAACAGCAAGAGGGGCTAGGGGAAAAGGAAAGGCTTTCAT
CTTTGTGGTGGGGAAGCAAGTAGGGTTGGCACGGAGGATAATTGAGCGAAATGAGAAAGGTCACCCAGTTCATGATGTCC
CAAACGCTTACGAGTTCACAACCTAA