Details for Arabidopsis Locus AT3G06950

Position : Chr3 ( 5`- 2192685 .. 2194321 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06950

Protein [Map View]
MSCVTPALPPSLFTNGYLSSPQNISMTNLNSSVKVSDSGAYKWRLVIAYDGTRFAGWQYQESPPTIQSMLEKALIQITEL
GRKELQLIGAGRTDAGVHAWGQVAHFVTPFNYTSLDSFHAALNGLLPKDIRVRELSAAVPEFHARFSASSKVYRYQIYND
TFMDPFQRHWAYHCAYKLNASKMREAANLFVGKHDFSAFANATREDGVPDPLKTISRFDVIQMGSLLQLEVEGSGFLYRQ
VRNMVALLIQIGKEALDSDIVPMILETKDRRVLAKYTSLPASPHGLCLVSVKYKEDHLKLPLDCPVTSSGRHHTITKCKL
PFY*

DNA
ATGAGTTGCGTTACACCAGCACTTCCTCCTTCACTCTTTACTAATGGGTATCTTTCGTCTCCTCAGAATATCTCCATGAC
CAACTTGAACAGTTCGGTAAAGGTTAGTGATTCTGGTGCTTATAAATGGCGCCTTGTGATAGCCTACGATGGCACCCGTT
TTGCAGGTTGGCAGTATCAGGAGTCACCACCAACTATCCAATCAATGTTAGAAAAAGCCTTAATTCAGATTACAGAGCTC
GGTAGAAAAGAGCTTCAGCTTATTGGAGCTGGCAGGACCGATGCAGGAGTTCACGCTTGGGGTCAGGTAGCTCATTTTGT
CACTCCTTTCAACTATACTAGTTTGGATAGCTTTCACGCTGCTTTGAACGGTCTTCTTCCTAAAGATATCCGTGTCAGAG
AGCTGAGTGCAGCGGTTCCTGAGTTTCATGCTCGGTTTTCTGCCTCTAGCAAGGTTTATCGCTACCAGATATACAACGAC
ACTTTCATGGACCCGTTCCAGCGTCATTGGGCTTACCACTGTGCTTATAAACTGAATGCTTCTAAAATGCGGGAAGCTGC
AAATCTTTTTGTTGGAAAGCATGATTTCTCTGCATTTGCTAACGCTACTCGGGAAGATGGAGTACCTGATCCTTTGAAAA
CTATATCTCGCTTCGATGTCATTCAAATGGGATCTCTTCTACAGCTTGAAGTTGAAGGTTCTGGCTTTTTGTACAGACAA
GTCAGAAACATGGTAGCTTTGCTGATTCAGATTGGAAAAGAAGCACTGGATTCAGACATTGTCCCAATGATTCTCGAAAC
CAAAGACAGGAGGGTGCTTGCAAAGTATACTAGTTTGCCTGCGTCGCCTCATGGTCTTTGTCTTGTGTCTGTTAAGTATA
AGGAAGATCATCTAAAGCTTCCATTGGATTGTCCTGTTACTAGTTCTGGTAGACATCACACTATAACAAAATGTAAACTT
CCCTTCTATTGA