Details for Arabidopsis Locus AT3G06910

Position : Chr3 ( 5`- 2178630 .. 2181197 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06910

Protein [Map View]
MKNQSRVLNSELGDFDLSVLWDQILNFEGYGSYCFRPMDMDGYHKRSAGLNPCKHSGFSHSSRPMAPGIYRYPEVKSSLR
RQVHAPVRILNSGRDRSTRQGSGNVLGTFLTRNNDMWKRNALDSSLRYRTDREVIDVDDELGDVEMISDDTSREGVENVA
MEVDEVEEKAEMGNGLFSEVASLKNGSLRVGECSKANSSSLVVNRPVTDVTSFEAYRKVLESAVNRTSKLKDRGFVDFFK
ERGRALLRSLSSFWRQDEEPVEVVQREAFVPLSREEETAVRRAFSANDSNILVTHKNSNIDITGKILRCLKPGKWLNDEV
INLYMVLLKEREAREPKKFLKCHFFNTFFFTKLVNSATGYNYGAVRRWTSMKRLGYHLKDCDKIFIPIHMNIHWTLAVIN
IKDQKFQYLDSFKGREPKILDALARYFVDEVRDKSEVDLDVSRWRQEFVQDLPMQRNGFDCGMFMVKYIDFYSRGLDLCF
TQEQMPYFRARTAKEILQLKAE*

DNA
ATGAAAAACCAATCTAGGGTTTTGAACTCTGAATTGGGGGATTTTGACCTTTCAGTTTTGTGGGATCAAATTTTGAATTT
CGAGGGTTATGGTTCCTACTGTTTCAGACCAATGGATATGGATGGTTACCACAAACGGAGCGCCGGTTTAAACCCTTGTA
AACACTCCGGTTTCTCACATTCATCAAGACCCATGGCTCCAGGAATTTACCGTTACCCAGAAGTGAAATCTTCGTTGCGG
AGACAAGTTCATGCGCCTGTGCGGATACTCAATAGCGGTCGAGATCGTAGCACACGACAAGGTTCTGGTAATGTGTTGGG
AACCTTTCTCACAAGGAACAATGACATGTGGAAAAGAAATGCACTTGATTCGTCTTTACGCTATAGAACGGATAGAGAAG
TAATTGATGTTGATGATGAGCTTGGAGATGTTGAAATGATATCTGATGATACAAGTAGGGAGGGTGTCGAAAACGTGGCT
ATGGAGGTGGACGAGGTGGAAGAGAAGGCGGAGATGGGAAATGGATTGTTTTCTGAGGTTGCCAGTCTGAAAAATGGGAG
CTTGAGGGTGGGTGAATGTTCTAAAGCTAATAGTAGTTCACTCGTTGTGAATCGCCCTGTGACTGATGTCACAAGTTTTG
AAGCATACAGAAAGGTTCTTGAGAGTGCTGTGAACCGGACTTCTAAACTGAAAGACAGAGGCTTTGTTGATTTTTTTAAA
GAGAGAGGTCGTGCTTTACTACGAAGCTTGTCTTCCTTTTGGAGACAAGATGAAGAACCAGTAGAGGTTGTACAACGTGA
GGCATTTGTACCTCTTTCTAGAGAGGAGGAGACAGCAGTCAGGCGTGCATTCTCAGCTAATGATTCAAACATCTTGGTTA
CTCATAAGAACTCAAATATTGATATTACCGGGAAAATCTTGAGGTGCCTTAAACCAGGCAAATGGTTGAACGATGAGGTC
ATTAATCTTTATATGGTATTGCTGAAAGAAAGGGAAGCTAGAGAACCAAAGAAGTTTCTTAAATGTCATTTTTTCAATAC
ATTTTTCTTCACTAAGTTAGTTAATTCGGCGACTGGATACAACTATGGTGCAGTGAGAAGATGGACTTCAATGAAGAGGT
TGGGCTACCATCTCAAAGACTGTGACAAGATATTTATCCCTATCCATATGAACATCCACTGGACTTTGGCTGTAATTAAT
ATAAAGGACCAGAAATTCCAGTATCTTGACTCTTTCAAAGGAAGGGAGCCTAAAATCCTCGATGCACTGGCTAGATACTT
TGTCGATGAAGTGAGGGATAAGAGTGAAGTAGACCTTGATGTAAGTCGATGGAGACAAGAATTTGTCCAGGACCTTCCAA
TGCAGAGAAATGGATTCGATTGTGGAATGTTTATGGTGAAATACATCGACTTCTATAGCAGAGGTCTGGATCTTTGTTTC
ACTCAGGAACAAATGCCATATTTCCGGGCTAGGACAGCAAAGGAGATTCTGCAACTGAAAGCCGAGTGA