Details for Arabidopsis Locus AT3G06880

Position : Chr3 ( 5`- 2169768 .. 2175686 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06880

Protein [Map View]
MAYLSSSQSTFISCSENSSLDSILVSINVYILGVISDPEAWISLKQKCITLLSIEEDNTLFEFSSEHSALSNLYWGIDSI
EASIHPECSEEKTSRLRNSERMLQMPALLDEQGTTTSGVPNTVLISFSYFYLSIVSYLQGDSLQSTLHFLQSVLVSPEIV
RTDIAPELCESIFFTPGVYKSDEEIREIARKYKYRATYYQVMSYGETHQPPRECIETPVRRQKEYGQEIFAANAHSVAEK
LELSETCEKLLQYQNLHSVDLQEEELNDIFNKIKASRKIEKSENNFEGSQCLDCNLQEDYNAEPGKSTRVRCLNEFLNES
QPDTREDIGTDTLANIFCVSQQQAHKEANKAYNEDTLANRSSSFIGNFNRSIFEIQAQQSKTTWNTHLEDASSLRQLDLE
EISVFGQKGSISFEGMRRNLQTKKRGNGLETLSRRAPTMDLWMNLQSLIKEVLGNADEKYVSEVTMIYQMLNRKEGFKYS
MLKDVILDQLFTAISSSEEKTVIKASMTALTKIISVNRTALEEVKRKGLNLSHLANALKQNVQEAAILIYLIKPSPTEIK
SLELLPALVDVVASTSSSSSCYTFIPSPSYLTPPAASLMIIEVLITAFDHATNTMHLAAISSPSVLCGLLDVAKSGNSGE
FISLTSILVKCMQFDGLHRKYIYQHTRVAPFAHLLQSKDQEEICIALQFLHEVLKIPRSSAIKILQQIKKEGSFDIKVTL
LHCIKHLQGDHKLFAADILLQLNALDSPPENKKYRNEATRALLDAVTYSEGSNMQLLSTFILANIGGTYSWTGEPYTAAW
LMKRGGLTSMSHMNMIRNINWSDECLQDTGIDGWCCKIARRIIDTGKATFCGLQEGLKSKNKSVSKACLIAIAWLSIEIS
KGPNSLKYSACEVLLDEVAQFLHPGLELEERLLACICIYNFSSGKGIHKLVNFSEGVRESLRRLSHVTWMADELHKATYY
LFSKSDQRISCVHTQTVEMHQSGSGAVTALIYHKGLLFSGFSDGSIRVWNVNKKIATLLWDIKEHKSTVTCFSLSETGEC
VLSGSADKTIRVWQIVKGKLECAEVIKTKDSIRKLEAFGNMIFVITKGHKMKLLDSSRISQSIFKGKGVKSMVSAQGKIY
IGCIDTSIQELIVANKREKEIKAPTRSWRLQNKPINSVVVYKDMLYSSSTYVEMSNIKDLRRNYEPQMSITAEKGSNIVA
MGVVEDFIYLNRSSSANTLQIWLRRTQQKVGRLSAGSKITSLLTANDIVFCGTEAGVIKGWIPL*

DNA
ATGGCTTACCTTTCATCTTCTCAATCGACTTTTATCTCATGTAGTGAGAATTCATCTCTTGATTCGATTCTAGTTTCAAT
CAACGTCTACATCCTCGGCGTCATATCAGACCCTGAAGCATGGATTTCGCTTAAGCAGAAATGCATCACATTGCTCAGCA
TTGAAGAAGATAATACTCTGTTTGAATTCTCCTCTGAACACTCTGCTCTCTCCAATCTCTATTGGGGAATCGATAGCATC
GAAGCTTCTATACATCCCGAATGCTCAGAAGAAAAGACGTCTCGTCTGAGAAACTCAGAGAGAATGCTTCAAATGCCTGC
GTTGCTTGACGAACAAGGGACCACCACTTCTGGTGTTCCAAACACAGTCTTGATTTCTTTCTCTTACTTTTACCTCTCCA
TTGTAAGCTATCTTCAAGGTGATTCCTTGCAGTCCACATTGCATTTTCTGCAGTCGGTTTTGGTCTCGCCGGAGATTGTA
AGAACCGACATTGCCCCTGAACTCTGCGAGAGCATTTTCTTCACTCCTGGTGTGTACAAGTCAGATGAAGAGATCAGAGA
GATTGCAAGAAAGTATAAATACAGAGCAACTTATTACCAAGTTATGTCCTATGGAGAGACTCATCAGCCGCCACGTGAAT
GTATAGAGACACCGGTTAGAAGGCAGAAGGAATATGGGCAAGAAATATTTGCGGCTAATGCACATTCAGTTGCAGAGAAG
CTAGAGTTGTCAGAAACTTGTGAGAAGTTATTGCAGTACCAGAACCTCCACAGTGTTGATTTGCAAGAGGAGGAACTTAA
TGACATTTTCAACAAAATCAAAGCATCAAGGAAGATTGAGAAATCTGAAAATAACTTCGAAGGTTCTCAATGTTTGGATT
GTAACCTGCAGGAAGATTACAATGCAGAGCCTGGAAAAAGTACAAGAGTCAGATGCCTTAATGAATTCTTGAACGAGTCT
CAGCCAGATACTAGAGAAGACATTGGCACGGACACATTAGCAAACATCTTCTGTGTTTCCCAACAACAAGCTCACAAGGA
AGCAAACAAAGCTTATAATGAGGACACATTAGCCAACAGATCCAGCAGTTTTATCGGTAATTTTAACCGTTCTATCTTTG
AAATTCAGGCTCAACAATCAAAGACAACTTGGAATACCCACTTAGAAGATGCATCTTCTTTGAGGCAACTAGATTTGGAA
GAAATATCAGTATTTGGACAAAAAGGGTCCATAAGTTTTGAAGGAATGAGGAGAAATTTGCAGACCAAAAAACGAGGGAA
TGGACTTGAGACGCTTTCTAGAAGAGCTCCAACAATGGATTTATGGATGAACCTTCAGAGCTTGATAAAGGAAGTGTTAG
GGAATGCAGATGAGAAATATGTCTCAGAGGTTACAATGATATATCAAATGCTGAACAGGAAAGAAGGATTCAAGTATAGC
ATGCTAAAAGATGTCATTCTGGATCAGCTGTTTACGGCTATTTCTAGTTCCGAGGAGAAGACCGTGATTAAGGCGTCGAT
GACGGCACTTACCAAGATCATATCAGTTAATAGAACAGCTCTTGAGGAGGTCAAAAGGAAGGGTTTAAATTTAAGTCATT
TAGCAAATGCTCTCAAACAAAATGTGCAAGAAGCAGCTATTCTCATCTACCTGATAAAGCCATCTCCAACAGAAATAAAG
AGTCTTGAGCTTTTACCAGCTCTTGTTGATGTTGTTGCATCCACTTCTTCTTCATCTTCTTGTTACACATTTATACCTTC
ACCTTCTTATTTGACGCCGCCTGCAGCATCATTGATGATAATTGAAGTGCTTATCACTGCTTTTGATCATGCTACAAACA
CAATGCACTTGGCTGCAATCAGCTCTCCTTCTGTCCTTTGTGGACTTCTTGATGTTGCAAAGAGTGGAAACTCAGGGGAA
TTCATCTCCTTGACAAGTATTTTAGTAAAATGCATGCAATTTGATGGACTTCACAGGAAGTATATTTATCAGCATACTCG
AGTGGCTCCTTTTGCGCATCTCCTGCAAAGCAAAGACCAAGAAGAAATTTGCATTGCTCTTCAATTTCTTCATGAGGTCC
TGAAGATACCAAGGTCATCAGCAATCAAGATTCTGCAACAGATAAAGAAAGAAGGAAGTTTTGACATTAAGGTCACATTA
TTGCACTGTATTAAACACTTGCAGGGTGATCACAAACTCTTTGCAGCAGATATATTGCTTCAGTTAAATGCACTGGATTC
TCCACCTGAGAACAAAAAGTACAGAAATGAAGCTACCAGAGCTCTACTTGATGCAGTTACATATAGTGAAGGTTCAAATA
TGCAGCTTTTATCAACGTTCATTCTTGCGAATATCGGTGGAACTTATTCATGGACAGGAGAACCTTACACTGCTGCTTGG
CTAATGAAAAGAGGAGGTCTAACTTCTATGTCACATATGAATATGATAAGAAACATCAACTGGTCAGATGAATGCTTGCA
GGATACAGGAATAGATGGATGGTGTTGTAAGATAGCTAGAAGAATTATTGATACAGGCAAAGCCACGTTTTGTGGTTTAC
AAGAAGGGCTAAAGAGTAAAAACAAGAGTGTTTCAAAAGCATGTCTTATAGCCATTGCATGGCTCAGTATAGAGATTTCA
AAAGGTCCAAATAGTTTAAAATACTCAGCATGTGAAGTTTTACTTGATGAGGTAGCACAATTTCTCCACCCTGGTTTGGA
GCTTGAAGAAAGACTTCTTGCTTGTATATGCATCTATAATTTTAGCTCTGGCAAAGGAATCCACAAACTAGTCAATTTCT
CGGAAGGAGTTAGAGAGTCTTTGAGACGTCTTTCACATGTGACTTGGATGGCAGACGAACTGCATAAAGCAACATATTAT
CTATTCAGCAAATCTGACCAACGCATATCTTGTGTTCATACACAAACCGTAGAGATGCATCAATCTGGCAGTGGAGCTGT
AACAGCACTCATCTACCATAAAGGCTTGCTCTTTAGTGGATTCTCAGATGGTTCAATCAGGGTGTGGAATGTGAATAAGA
AAATAGCTACGCTTTTATGGGACATCAAGGAGCACAAAAGCACAGTAACATGCTTTTCACTCTCTGAAACAGGAGAGTGT
GTCTTAAGTGGATCAGCAGATAAAACTATCAGGGTATGGCAGATAGTTAAAGGAAAACTGGAATGTGCTGAAGTCATAAA
AACAAAAGATTCAATAAGGAAACTGGAAGCATTCGGAAATATGATCTTTGTTATAACAAAAGGGCACAAGATGAAGCTGC
TTGATTCATCAAGAATATCTCAAAGTATCTTCAAAGGTAAAGGTGTGAAGAGTATGGTATCAGCTCAAGGAAAGATTTAT
ATAGGATGCATAGATACAAGTATACAGGAATTAATTGTTGCAAATAAACGGGAGAAAGAGATTAAAGCACCGACGAGGAG
CTGGAGACTTCAAAACAAGCCTATCAATTCAGTGGTTGTGTACAAAGATATGTTATATAGCTCAAGCACATATGTTGAGA
TGTCTAATATAAAGGATCTGAGAAGGAACTATGAGCCCCAAATGTCAATAACAGCAGAAAAGGGGTCTAATATAGTAGCA
ATGGGTGTTGTTGAAGACTTCATCTACCTGAATCGAAGTTCATCCGCAAACACTCTTCAGATTTGGTTGAGAAGGACACA
ACAGAAAGTGGGAAGACTATCAGCAGGAAGCAAGATAACAAGCCTCCTTACTGCTAATGACATTGTTTTTTGCGGTACAG
AAGCTGGGGTCATTAAGGGATGGATTCCGTTATAG