Details for Arabidopsis Locus AT3G06868

Position : Chr3 ( 5`- 2167730 .. 2169222 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06868

Protein [Map View]
MVELKDQQDMGEGMQCITHPYTKNPGGICALCLQEKLGKLVTSSFPVPKPNHLSSSSPKSFTPSTTSLALSLSSASNGRD
STNNNNLPFLLAKKKKNMLAASSSSSSSSSSSSSANLIYKRSKSTAAAYGESFSQRKRSGFWSFFHLYSSKHQISNTTKK
VDNFSHLRRNQRTESKTETSSMRVGGGGGIDVIVEEEDESPNKVVSETPTNGIGGGGGSSFGRKVLRSRSVGCGSRSFSG
DFFERISNGFGDCALRRIESQREATKVISNGGGGEAADAMSEMVKCGGIFGGFMIMTSSSTTSSTTSSTVDHHHNHKMGN
RNWGWAFASPMRAKATATHRGRTITESTADNKNTSSNLDSIPSLLALKS*

DNA
ATGGTGGAGCTCAAAGATCAACAAGACATGGGAGAAGGTATGCAATGCATTACACATCCTTACACAAAGAACCCAGGTGG
GATCTGTGCTTTATGTCTCCAGGAAAAGCTTGGTAAGCTCGTCACTTCCTCTTTCCCTGTTCCTAAACCCAACCATCTCT
CTTCTTCTTCTCCTAAATCCTTCACTCCTTCCACGACCTCTCTCGCTCTGTCTCTCTCATCGGCAAGCAATGGCAGAGAC
TCCACTAACAACAACAATCTCCCGTTTCTTCTGGCTAAGAAGAAGAAGAACATGCTCGCAGCTTCTTCTTCATCTTCTTC
TTCTTCCTCTTCGTCTTCTTCTGCGAATCTTATCTACAAGAGAAGCAAATCGACTGCTGCTGCTTACGGTGAGAGTTTCA
GCCAAAGGAAACGAAGTGGGTTTTGGTCTTTTTTCCATCTCTACTCTTCAAAACATCAGATCAGCAACACCACCAAAAAA
GTCGATAACTTTAGCCATTTAAGGAGGAACCAGAGAACAGAGTCAAAAACAGAGACTTCTTCCATGAGGGTCGGTGGTGG
TGGAGGCATTGATGTGATAGTTGAGGAAGAAGATGAGAGTCCTAACAAAGTGGTTTCAGAAACGCCAACGAATGGTATAG
GTGGTGGTGGTGGTTCGTCGTTTGGGAGGAAAGTGTTGAGATCTAGATCTGTTGGTTGTGGTAGTAGAAGCTTCTCTGGT
GATTTCTTTGAGAGGATCTCTAATGGGTTTGGTGATTGTGCCTTGAGAAGGATTGAGTCACAGAGAGAAGCCACTAAGGT
CATTAGTAATGGTGGTGGTGGTGAAGCAGCAGATGCAATGAGTGAAATGGTCAAATGTGGTGGCATCTTTGGTGGGTTTA
TGATCATGACATCATCATCTACAACATCATCAACAACATCATCAACGGTTGATCATCATCATAATCATAAGATGGGGAAC
AGAAACTGGGGATGGGCTTTCGCAAGTCCAATGAGAGCCAAAGCTACTGCTACTCATAGAGGTCGTACCATTACAGAGTC
CACAGCTGACAACAAGAACACATCTTCAAATTTGGACTCAATCCCTTCATTGTTGGCTTTGAAAAGCTAA