Details for Arabidopsis Locus AT3G06860

Position : Chr3 ( 5`- 2161869 .. 2166349 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06860

Protein [Map View]
MDSRTKGKTVMEVGGDGVAVITLINPPVNSLSFDVLYNLKSNYEEALSRNDVKAIVITGAKGRFSGGFDISGFGEMQKGN
VKEPKAGYISIDIITDLLEAARKPSVAAIDGLALGGGLELAMACHARISAPAAQLGLPELQLGVIPGFGGTQRLPRLVGL
TKALEMILTSKPVKAEEGHSLGLIDAVVPPAELVTTARRWALDIVGRRKPWVSSVSKTDKLPPLGEAREILTFAKAQTLK
RAPNMKHPLMCLDAIEVGIVSGPRAGLEKEAEVASQVVKLDTTKGLIHVFFSQRGTAKVPGVTDRGLVPRKIKKVAIIGG
GLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVKANLQSRVRKGSMSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVI
ENISLKQQIFADLEKYCPQHCILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHIMPLLEIVRTNHTSAQVIVDLLDVG
KKIKKTPVVVGNCTGFAVNRMFFPYTQAAMFLVECGADPYLIDRAISKFGMPMGPFRLCDLVGFGVAIATATQFIENFSE
RTYKSMIIPLMQEDKRAGEATRKGFYLYDDKRKAKPDPELKKYIEKARSISGVKLDPKLANLSEKDIIEMTFFPVVNEAC
RVFAEGIAVKAADLDIAGIMGMGFPPYRGGIMFWADSIGSKYIYSRLDEWSKAYGEFFKPCAFLAERGSKGVLLSAPVKQ
ASSRL*

DNA
ATGGATTCACGAACCAAGGGGAAGACGGTGATGGAAGTTGGTGGCGATGGCGTTGCCGTCATAACACTCATCAATCCTCC
CGTCAATTCTCTATCCTTCGACGTGCTATACAATCTCAAAAGTAATTACGAGGAGGCCTTGAGCAGGAATGATGTTAAAG
CTATTGTTATTACTGGTGCAAAGGGGAGGTTCTCTGGTGGCTTTGATATATCTGGTTTTGGTGAAATGCAGAAGGGGAAT
GTCAAAGAGCCAAAGGCTGGTTACATTTCGATTGACATCATAACCGACTTGCTTGAAGCTGCTAGGAAACCGTCTGTCGC
TGCCATTGATGGACTTGCCTTGGGAGGAGGATTAGAACTTGCTATGGCTTGTCATGCTAGGATATCAGCTCCTGCTGCAC
AGTTAGGCTTGCCTGAGCTGCAACTTGGTGTTATTCCTGGTTTTGGAGGAACGCAGCGTCTCCCGCGTCTTGTTGGTCTC
ACCAAAGCCCTTGAAATGATTTTGACATCTAAGCCAGTTAAAGCTGAGGAAGGTCATTCTTTGGGTCTTATTGATGCTGT
GGTGCCACCTGCGGAGTTAGTAACCACTGCTCGTCGCTGGGCCCTTGACATAGTCGGGAGGAGAAAACCATGGGTATCTA
GTGTTTCCAAGACTGATAAGTTACCTCCTCTTGGAGAGGCAAGGGAGATACTGACGTTTGCCAAGGCACAGACACTCAAG
CGTGCCCCCAATATGAAACACCCTTTAATGTGCCTTGACGCTATTGAAGTAGGTATTGTTTCTGGTCCAAGGGCTGGTTT
AGAAAAGGAAGCTGAAGTCGCCTCACAAGTGGTAAAACTGGATACCACCAAAGGCTTGATCCACGTCTTCTTTTCTCAGC
GAGGAACTGCTAAGGTTCCTGGAGTTACTGATCGTGGGTTGGTGCCAAGGAAGATTAAGAAGGTAGCCATAATTGGAGGC
GGGTTGATGGGATCTGGAATAGCTACTGCGTTGATCCTAAGTAACTATCCAGTGATTCTCAAGGAGGTAAATGAGAAATT
CCTGGAGGCTGGAATTGGCAGAGTTAAAGCTAATCTCCAGAGCCGTGTAAGGAAGGGAAGCATGTCTCAGGAAAAGTTTG
AGAAAACCATGTCTCTCCTTAAGGGTTCTCTTGATTATGAAAGCTTTAGAGATGTGGACATGGTCATTGAGGCTGTTATT
GAGAATATATCTTTGAAGCAACAAATTTTTGCTGATCTGGAGAAATACTGTCCTCAGCATTGTATCCTTGCTAGCAACAC
ATCGACCATTGACTTGAACAAAATTGGGGAGCGGACCAAGTCTCAGGATCGAATTGTTGGAGCACATTTTTTCAGTCCAG
CACATATCATGCCGCTACTTGAAATAGTTCGGACCAATCATACCTCTGCCCAAGTAATTGTTGACCTGTTAGATGTTGGG
AAGAAGATTAAGAAAACACCAGTTGTGGTGGGAAACTGCACAGGGTTTGCAGTGAATAGGATGTTCTTCCCTTACACACA
GGCAGCTATGTTCCTTGTTGAGTGTGGAGCAGATCCATATCTAATCGACAGGGCAATCAGCAAGTTTGGAATGCCAATGG
GTCCCTTCAGACTGTGTGACCTGGTTGGATTTGGTGTGGCGATTGCAACCGCAACGCAGTTTATCGAGAACTTCTCAGAA
CGGACTTACAAATCAATGATTATTCCACTTATGCAAGAGGACAAGAGAGCTGGTGAAGCCACTCGCAAAGGTTTCTATTT
GTATGATGATAAGCGCAAGGCGAAACCTGATCCTGAGCTAAAGAAATATATCGAAAAGGCAAGAAGCATATCTGGAGTAA
AGCTTGACCCTAAGTTGGCGAATTTGTCGGAGAAGGACATTATTGAAATGACATTCTTCCCAGTAGTAAACGAGGCGTGT
AGGGTTTTTGCTGAAGGTATCGCTGTCAAAGCAGCAGACCTTGACATTGCTGGCATAATGGGAATGGGTTTTCCACCTTA
CAGAGGAGGAATCATGTTCTGGGCTGATTCCATCGGATCGAAATACATTTACTCGAGGCTGGATGAGTGGTCGAAGGCTT
ATGGTGAATTCTTCAAGCCTTGTGCTTTTTTGGCTGAGAGGGGATCTAAAGGAGTTCTTTTGAGCGCTCCCGTGAAACAA
GCCAGCTCACGGTTGTAA