Details for Arabidopsis Locus AT3G06850

Position : Chr3 ( 5`- 2157974 .. 2160623 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06850

Protein [Map View]
MIARRIWRSHRFLRPFSSSSVCSPPFRVPEYLSQSSSSPASRPFFVHPPTLMKWGGGSRSWFSNEAMATDSNSGLIDVPL
AQTGEGIAECELLKWFVKEGDSVEEFQPLCEVQSDKATIEITSRFKGKVALISHSPGDIIKVGETLVRLAVEDSQDSLLT
TDSSEIVTLGGSKQGTENLLGALSTPAVRNLAKDLGIDINVITGTGKDGRVLKEDVLRFSDQKGFVTDSVSSEHAVIGGD
SVSTKASSNFEDKTVPLRGFSRAMVKTMTMATSVPHFHFVEEINCDSLVELKQFFKENNTDSTIKHTFLPTLIKSLSMAL
TKYPFVNSCFNAESLEIILKGSHNIGVAMATEHGLVVPNIKNVQSLSLLEITKELSRLQHLAANNKLNPEDVTGGTITLS
NIGAIGGKFGSPLLNLPEVAIIALGRIEKVPKFSKEGTVYPASIMMVNIAADHRVLDGATVARFCCQWKEYVEKPELLML
QMR*

DNA
ATGATCGCGCGACGGATCTGGCGAAGCCACCGGTTTCTCCGCCCATTCAGCTCGTCATCTGTTTGCTCTCCGCCGTTCCG
GGTACCGGAGTATCTTTCTCAGTCGTCTTCCTCTCCGGCGTCGCGCCCATTCTTTGTTCACCCTCCCACTTTGATGAAAT
GGGGTGGAGGAAGTAGAAGCTGGTTTTCGAACGAAGCCATGGCCACTGATTCAAATTCAGGGTTAATTGATGTGCCACTA
GCTCAAACTGGGGAAGGTATTGCTGAATGTGAGCTTCTCAAGTGGTTTGTCAAAGAGGGAGATTCTGTGGAAGAGTTTCA
GCCACTCTGTGAAGTTCAGAGCGATAAAGCAACTATAGAGATCACAAGTCGTTTTAAAGGGAAAGTGGCTCTGATTTCAC
ATTCTCCAGGTGACATTATTAAGGTTGGAGAGACTCTGGTTAGGTTGGCGGTTGAAGACTCGCAGGATTCGCTTCTAACC
ACTGATAGTTCAGAAATTGTAACTCTGGGAGGTTCAAAGCAGGGAACAGAAAATCTTCTTGGAGCTCTCTCAACGCCTGC
GGTTCGTAACCTTGCAAAAGACCTTGGCATAGATATCAATGTTATAACTGGAACTGGTAAAGATGGTAGAGTTTTGAAAG
AGGATGTTCTCCGGTTTAGTGACCAGAAAGGATTTGTAACAGATTCAGTTTCTTCTGAGCATGCTGTTATAGGAGGAGAC
TCGGTTTCCACTAAAGCTAGTAGTAACTTTGAAGATAAAACAGTTCCTCTAAGGGGATTCAGCCGAGCAATGGTCAAGAC
AATGACTATGGCTACAAGTGTACCGCATTTTCATTTTGTTGAAGAGATAAACTGCGACTCACTTGTGGAGCTCAAGCAGT
TCTTCAAAGAGAACAATACAGATTCCACCATCAAACACACTTTTCTTCCTACTTTAATCAAGTCTCTGTCAATGGCTCTA
ACCAAATATCCCTTCGTGAATAGTTGCTTCAACGCGGAATCTCTCGAGATCATTCTCAAAGGTTCACATAATATTGGAGT
TGCAATGGCCACTGAACATGGCCTTGTCGTTCCTAATATAAAGAATGTTCAGTCATTATCTCTGCTAGAGATAACCAAAG
AGCTGTCCCGGTTACAACATTTGGCAGCAAACAACAAACTTAACCCCGAGGATGTGACTGGTGGAACCATAACTCTGAGT
AACATTGGAGCAATTGGTGGTAAATTCGGATCCCCTCTTTTAAACTTACCGGAAGTTGCAATCATCGCTCTTGGAAGAAT
CGAGAAAGTTCCAAAATTCTCAAAAGAAGGAACTGTCTATCCTGCATCGATAATGATGGTTAACATTGCTGCGGATCATA
GAGTTCTAGATGGGGCAACGGTAGCTCGGTTTTGCTGCCAGTGGAAAGAGTATGTCGAGAAACCGGAGCTGCTGATGCTT
CAAATGAGATAA