Details for Arabidopsis Locus AT3G06840

Position : Chr3 ( 5`- 2156862 .. 2157850 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06840

Protein [Map View]
MSNISPIFSISNSQHFSDYGFDPQLHYFQVMEEARKHKRETSSKSYTNGLQFKIQKPISKDNPTRSTMHNDKKKKRCWWK
KALPFFKWRKWPISTVGVNEDRRVRNFRSVTGSMSMSGPIYATESLISGSNTPYRTTTSKPSSGPIAGTLTPARKGDVAI
PYLSLRELNMEQPQRISISSSPIYLVT*

DNA
ATGTCAAACATTTCCCCAATCTTCTCCATCTCCAACTCTCAACATTTCAGCGACTATGGCTTCGATCCCCAACTCCACTA
CTTTCAGGTTATGGAAGAAGCGAGGAAGCATAAGAGAGAAACGTCATCAAAATCATACACGAACGGTCTTCAATTCAAGA
TCCAGAAACCCATTTCAAAAGACAACCCGACCCGGTCCACAATGCACAACGACAAGAAGAAGAAACGGTGTTGGTGGAAG
AAAGCTCTCCCTTTTTTCAAATGGCGGAAATGGCCAATCTCCACCGTCGGCGTGAACGAAGATCGTAGGGTCAGGAACTT
TCGCTCCGTAACCGGGTCCATGTCAATGTCGGGTCCGATTTACGCAACGGAGAGTCTAATAAGTGGGTCGAACACACCGT
ATCGTACAACAACGAGTAAACCTTCGTCGGGACCTATAGCGGGAACATTGACGCCGGCGAGGAAAGGTGACGTGGCGATT
CCTTATCTGAGCTTACGAGAGCTTAACATGGAGCAGCCACAGAGGATTTCTATCTCTTCTTCCCCAATTTACTTGGTCAC
GTAA