Details for Arabidopsis Locus AT3G06820

Position : Chr3 ( 5`- 2150847 .. 2153440 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06820

Protein [Map View]
MSLTCVNMSEDVWLTCLTHALSTETEEIMGLLLGDIEYSKNGESATAMIWGASPQPRSDRQKDRVETNPEQLAAASAQAD
RMTISTGRTTRVIGWYHSHPHITVLPSHVDVRTQAMYQLLDSGFIGLIFSCFSEDANKVGRIQVIAFQSSDGKPNSIPKS
MSLVLANKDSVIDIESSSSSSDSIYQRSSSSKPELDTIDTATTSGSKGGGRVSDFGPFFTNNIEANITGRDETHKSGNLS
STTIGIDSMDMSESMQEAMLRSNLDTSGAGYVRKEVPLHVLPTSSLLPVNSPLASFKSLQRVLYEEERAAYYQSVQQNMR
DGRVHPLAFIHNTSTYQASMCKLIEYCLSPAINALQDRQKENKIRLAMLMDEAEVLEAQKLKGAETSRRPSHLVHGSGSR
SRRGS*

DNA
ATGTCTCTGACATGCGTAAATATGTCGGAGGATGTCTGGTTGACTTGCCTCACTCACGCATTATCCACCGAGACCGAAGA
AATCATGGGTCTCCTTCTCGGCGACATCGAGTACTCAAAGAACGGCGAAAGTGCCACAGCTATGATCTGGGGAGCATCGC
CTCAGCCACGATCTGATCGGCAGAAGGATCGAGTTGAAACCAATCCTGAACAATTGGCTGCTGCTTCTGCTCAGGCTGAT
AGAATGACGATATCAACGGGCAGAACTACACGGGTCATTGGATGGTACCACTCCCATCCTCATATTACCGTTCTTCCTTC
CCATGTCGATGTTCGGACACAAGCTATGTATCAGCTTTTAGATTCTGGTTTTATTGGCCTCATATTTTCCTGTTTTAGTG
AAGATGCTAACAAGGTTGGTAGAATCCAAGTTATCGCTTTCCAGTCTTCTGATGGAAAGCCGAATAGTATTCCTAAATCA
ATGAGCCTGGTTCTTGCTAATAAAGATTCTGTCATCGATATAGAATCTTCATCTAGTTCTTCGGACTCGATATACCAGCG
ATCCTCTTCTTCTAAGCCCGAGCTAGACACAATTGATACTGCTACAACTTCCGGATCTAAGGGTGGAGGACGGGTTTCAG
ATTTTGGGCCTTTCTTTACAAACAATATTGAGGCCAATATCACCGGCAGAGATGAAACTCACAAATCAGGCAATCTCAGC
AGCACAACTATAGGAATTGACTCGATGGACATGTCTGAAAGTATGCAAGAGGCAATGCTCCGTTCAAATTTAGATACCAG
TGGTGCGGGGTATGTTAGAAAAGAAGTCCCACTTCATGTTTTGCCAACTTCATCCCTTCTTCCAGTCAATTCACCTTTAG
CATCTTTTAAAAGCCTGCAACGAGTACTGTACGAGGAGGAACGAGCAGCGTACTACCAATCAGTGCAGCAAAACATGAGA
GATGGGCGAGTTCATCCTCTTGCTTTCATTCACAACACATCAACATATCAAGCCTCCATGTGCAAGTTGATCGAATACTG
CTTGAGTCCTGCCATTAACGCACTTCAAGATAGGCAGAAGGAGAACAAGATCCGGTTAGCAATGCTGATGGATGAAGCTG
AGGTTTTGGAGGCACAAAAACTTAAAGGAGCAGAGACAAGCCGGAGACCATCTCATCTGGTTCACGGTTCTGGCAGCCGA
AGCAGAAGAGGATCGTAG